diff --git a/.dockerignore b/.dockerignore index 223f56a14..660a5f3b2 100644 --- a/.dockerignore +++ b/.dockerignore @@ -1,14 +1,21 @@ -# Data directories - these will be accessed via volume mount -data/ -results/ -logs_to_keep/ +# Generated data payloads are accessed via a volume mount. Keep the root +# compatibility modules and the packaged speedrunning_plms.data source code. +/data/* +!/data/ +!/data/*.py +/results/ +/logs_to_keep/ # Cache directories .cache/ +.pytest_cache/ __pycache__/ *.pyc *.pyo *.pyd +*.egg-info/ +build/ +dist/ # Git files .git/ @@ -45,4 +52,4 @@ logs/ # Temporary files tmp/ -temp/ \ No newline at end of file +temp/ diff --git a/Dockerfile b/Dockerfile index 2f2998ae4..16e9f92ea 100644 --- a/Dockerfile +++ b/Dockerfile @@ -34,14 +34,16 @@ WORKDIR /app COPY requirements.txt . RUN pip install --upgrade pip setuptools && \ - pip install -r requirements.txt -U && \ - pip install --force-reinstall torch torchvision --index-url https://download.pytorch.org/whl/cu128 -U && \ - pip install numpy==1.26.4 - + pip install torch torchvision --index-url https://download.pytorch.org/whl/cu128 -U && \ + pip install -r requirements.txt # 5️⃣ Copy the rest of the source COPY . . +# Install the package and its repository test tooling. Runtime dependencies +# were installed above, so this also validates the package metadata in-image. +RUN pip install -e ".[test]" + # 6️⃣ Change working directory to where the volume will be mounted WORKDIR /workspace @@ -69,4 +71,4 @@ RUN mkdir -p \ VOLUME ["/workspace"] # 8️⃣ Default command – override in `docker run … python train.py` -CMD ["bash"] \ No newline at end of file +CMD ["bash"] diff --git a/MANIFEST.in b/MANIFEST.in new file mode 100644 index 000000000..34dce3267 --- /dev/null +++ b/MANIFEST.in @@ -0,0 +1,6 @@ +include LICENSE +include README.md +include requirements.txt +recursive-include example_yamls *.yaml +recursive-include evaluation *.py *.json +recursive-include tests *.py diff --git a/README.md b/README.md index 9d66b5b56..4a8f056a0 100644 --- a/README.md +++ b/README.md @@ -166,6 +166,43 @@ flowchart TB ## Getting Started +### Python package + +Install the reusable model, data, optimizer, and training modules from the +repository root: + +```bash +python -m pip install . +``` + +Install optional experiment tracking and launch dependencies with: + +```bash +python -m pip install ".[training]" +``` + +Install benchmark dependencies with `python -m pip install ".[evaluation]"`. + +Models saved with `save_pretrained()` include the custom model code and +canonical Transformers `AutoClass` metadata. A local checkpoint can be loaded +directly with `PLM.from_pretrained(path)`. A model repository can be loaded as +custom code after inspecting its source and pinning an immutable revision: + +```python +from transformers import AutoModelForMaskedLM + +model = AutoModelForMaskedLM.from_pretrained( + "organization/model-name", + trust_remote_code=True, + revision="full-hub-commit-sha", + code_revision="full-hub-commit-sha", +) +``` + +The model follows the standard masked-language-model interface. Batched +`input_ids`, `attention_mask`, and optional `labels` return a +`MaskedLMOutput` with `loss` and `logits`. + ### Quick Start On many popular HPC platforms will be missing Python headers `Python.h` which break `torch.compile`. To fix this, run the following code: @@ -217,11 +254,17 @@ sudo docker run --gpus all --shm-size=128g -v ${PWD}:/workspace speedrun_plm \ torchrun --standalone --nproc_per_node=NUM_GPUS_ON_YOUR_SYSTEM train.py ``` -Some key arguments for `train.py` include +Some key arguments for `train.py` include: -`--hf_token YOUR_HUGGINGFACE_TOKEN`, a Huggingface write token is required to save your models to Huggingface hub -`--wandb_token YOUR_WANDB_TOKEN`, is required for Weights and Biases (WANDB) logging -`--yaml_path YOUR_YAML_FILE`, points to an experimental set up with more settings. See `example_yamls/default.yaml` for inspiration +- `--push_to_hub --hf_model_name ORGANIZATION/MODEL` explicitly enables final model publication. Publication is disabled by default. +- `--hf_token YOUR_HUGGINGFACE_TOKEN` authenticates an opted-in Hub publication. +- `--wandb_token YOUR_WANDB_TOKEN` enables Weights and Biases logging. +- `--yaml_path YOUR_YAML_FILE` points to an experiment configuration. See `example_yamls/default.yaml`. + +When publication is enabled, training uploads one complete artifact containing +weights, configuration, remote code, and its runtime requirements only after +training and final evaluation succeed. No code-only artifact is uploaded at +startup. See [Command-line Argument](#command-line-arguments) for the full list of argument. @@ -271,7 +314,7 @@ This script will automatically: | Argument | Type | Default | Description | |----------|------|---------|-------------| | `--yaml_path` | str | None | Path to YAML file with experiment configuration. CLI arguments override YAML. | -| `--hf_token` | str | None | HuggingFace token (required for model saving/uploading). Prompted if not provided. | +| `--hf_token` | str | None | Hugging Face token for an explicitly enabled publication. | | `--wandb_token` | str | None | Weights & Biases API token (for experiment tracking). Prompted if not provided. | | `--log_name` | str | None | Name for the log file and wandb run. If not set, a random UUID is used. | | `--bugfix` | flag | False | Use small batch size and max length for debugging. | @@ -314,7 +357,8 @@ This script will automatically: | `--lr_hidden` | float | 0.05 | Learning rate for hidden layers (Muon). | | `--muon_momentum_warmup_steps` | int | 300 | Steps for Muon momentum warmup (0.85 → 0.95). | | `--eval_every` | int | 1000 | Evaluate on validation set every N steps. | -| `--hf_model_name` | str | "lhallee/speedrun" | HuggingFace model name for saving. | +| `--push_to_hub` | flag | False | Publish one complete final model artifact after successful training and evaluation. | +| `--hf_model_name` | str | None | Hugging Face destination repository used with `--push_to_hub`. | | `--save_every` | int | None | Save checkpoint every N steps (if set). | | `--num_workers` | int | 4 | Number of workers for optimized dataloader. | | `--prefetch_factor` | int | 2 | Prefetch factor for optimized dataloader. | @@ -323,6 +367,11 @@ This script will automatically: ## Performance Benchmarks +`evaluation/benchmark_esm.py` loads every model, remote-code module, +tokenizer, and dataset from the full commit SHA recorded in +`evaluation/benchmark_manifest.json`. Update that manifest intentionally when +changing benchmark inputs so result provenance remains reproducible. + ### Recommended Configuration Batch sizes of 8×64×1024 (524,288) or 4×64×1024 (262,144) tokens have demonstrated excellent performance. We recommend a local batch size of 64×1024 (65,536) tokens for 80GB VRAM systems, with adjustments for smaller configurations. diff --git a/data/__init__.py b/data/__init__.py new file mode 100644 index 000000000..10bf53a89 --- /dev/null +++ b/data/__init__.py @@ -0,0 +1,8 @@ +import sys +from pathlib import Path + +_SRC = Path(__file__).resolve().parents[1] / "src" +if str(_SRC) not in sys.path: + sys.path.insert(0, str(_SRC)) + +from speedrunning_plms.data import * # noqa: F401,F403 diff --git a/data/create_og90_splits.py b/data/create_og90_splits.py index 76cd384a3..8ce10d6f4 100644 --- a/data/create_og90_splits.py +++ b/data/create_og90_splits.py @@ -1,33 +1,22 @@ import argparse -from datasets import load_dataset, DatasetDict +import sys +from pathlib import Path -parser = argparse.ArgumentParser() -parser.add_argument('--hf_token', type=str, default=None) +_SRC = Path(__file__).resolve().parents[1] / "src" +if str(_SRC) not in sys.path: + sys.path.insert(0, str(_SRC)) -args = parser.parse_args() +from speedrunning_plms.data.splits import build_og_prot90_splits, login_if_token, push_splits -if args.hf_token: - import huggingface_hub - huggingface_hub.login(token=args.hf_token) -data = load_dataset('tattabio/OG_prot90', split='train').remove_columns('id').shuffle(seed=11) -#data = data.cast_column('sequence', Value(dtype='string')) -print(data) +def main() -> None: + parser = argparse.ArgumentParser() + parser.add_argument("--hf_token", type=str, default=None) + args = parser.parse_args() + login_if_token(args.hf_token) + data = build_og_prot90_splits() + push_splits(data, "Synthyra/og_prot90") -data = data.train_test_split(test_size=20000, seed=22) -train = data['train'] -valid = data['test'] -valid = valid.train_test_split(test_size=10000, seed=33) -test = valid['test'] -valid = valid['train'] - -data = DatasetDict({ - 'train': train, - 'valid': valid, - 'test': test -}) - -print(data) - -data.push_to_hub('Synthyra/og_prot90') \ No newline at end of file +if __name__ == "__main__": + main() diff --git a/data/create_omgprot50_splits.py b/data/create_omgprot50_splits.py index 258f102f0..7bd311060 100644 --- a/data/create_omgprot50_splits.py +++ b/data/create_omgprot50_splits.py @@ -1,33 +1,22 @@ import argparse -from datasets import load_dataset, DatasetDict +import sys +from pathlib import Path -parser = argparse.ArgumentParser() -parser.add_argument('--hf_token', type=str, default=None) +_SRC = Path(__file__).resolve().parents[1] / "src" +if str(_SRC) not in sys.path: + sys.path.insert(0, str(_SRC)) -args = parser.parse_args() +from speedrunning_plms.data.splits import build_omg_prot50_splits, login_if_token, push_splits -if args.hf_token: - import huggingface_hub - huggingface_hub.login(token=args.hf_token) -data = load_dataset('tattabio/OMG_prot50', split='train').remove_columns('id').shuffle(seed=11) -#data = data.cast_column('sequence', Value(dtype='string')) -print(data) +def main() -> None: + parser = argparse.ArgumentParser() + parser.add_argument("--hf_token", type=str, default=None) + args = parser.parse_args() + login_if_token(args.hf_token) + data = build_omg_prot50_splits() + push_splits(data, "Synthyra/omg_prot50") -data = data.train_test_split(test_size=20000, seed=22) -train = data['train'] -valid = data['test'] -valid = valid.train_test_split(test_size=10000, seed=33) -test = valid['test'] -valid = valid['train'] - -data = DatasetDict({ - 'train': train, - 'valid': valid, - 'test': test -}) - -print(data) - -data.push_to_hub('Synthyra/omg_prot50') \ No newline at end of file +if __name__ == "__main__": + main() diff --git a/data/create_uniref50_splits.py b/data/create_uniref50_splits.py index 1fd06db54..cccab253f 100644 --- a/data/create_uniref50_splits.py +++ b/data/create_uniref50_splits.py @@ -1,35 +1,22 @@ import argparse -from datasets import load_dataset, DatasetDict, concatenate_datasets +import sys +from pathlib import Path -parser = argparse.ArgumentParser() -parser.add_argument('--hf_token', type=str, default=None) +_SRC = Path(__file__).resolve().parents[1] / "src" +if str(_SRC) not in sys.path: + sys.path.insert(0, str(_SRC)) -args = parser.parse_args() +from speedrunning_plms.data.splits import build_uniref50_splits, login_if_token, push_splits -if args.hf_token: - import huggingface_hub - huggingface_hub.login(token=args.hf_token) -data = load_dataset('agemagician/uniref50_09012025').remove_columns('id').remove_columns('name').shuffle(seed=11) -data = data.rename_column('text', 'sequence') -print(data) +def main() -> None: + parser = argparse.ArgumentParser() + parser.add_argument("--hf_token", type=str, default=None) + args = parser.parse_args() + login_if_token(args.hf_token) + data = build_uniref50_splits() + push_splits(data, "Synthyra/uniref50") -data = concatenate_datasets([data['train'], data['validation'], data['test']]) -data = data.train_test_split(test_size=20000, seed=22) - -train = data['train'] -valid = data['test'] -valid = valid.train_test_split(test_size=10000, seed=33) -test = valid['test'] -valid = valid['train'] - -data = DatasetDict({ - 'train': train, - 'valid': valid, - 'test': test -}) - -print(data) - -data.push_to_hub('Synthyra/uniref50') \ No newline at end of file +if __name__ == "__main__": + main() diff --git a/data/dataloading.py b/data/dataloading.py index 129e6d69f..4680a9f8d 100644 --- a/data/dataloading.py +++ b/data/dataloading.py @@ -1,983 +1,8 @@ -import torch -import random -import torch.utils.data as data +import sys from pathlib import Path -from transformers import EsmTokenizer -from typing import Tuple, Optional, List -from torch.utils.data import DataLoader, IterableDataset +_SRC = Path(__file__).resolve().parents[1] / "src" +if str(_SRC) not in sys.path: + sys.path.insert(0, str(_SRC)) -def _load_data_shard(file: Path): - # only reads the header, returns header data - # header is 256 int32 - header = torch.from_file(f"{file}", False, 256, dtype=torch.int32) - assert header[0] == 20240520, 'magic number mismatch in the data .bin file' - assert header[1] == 1, 'unsupported version' - num_tokens = int(header[2]) # number of tokens (claimed) - with file.open('rb', buffering=0) as f: - tokens = torch.empty(num_tokens, dtype=torch.uint8) - f.seek(256 * 4) - nbytes = f.readinto(tokens.numpy()) - assert nbytes == num_tokens, 'number of tokens read does not match header?' - return tokens - - -class EvalLoader(IterableDataset): - """An IterableDataset specifically for evaluation that distributes data by sequences, not files.""" - - def __init__( - self, - filename_pattern: str, - seq_len: int, - process_rank: int, - num_processes: int, - tokenizer: EsmTokenizer, - ): - self.filename_pattern = filename_pattern - self.seq_len = seq_len - self.process_rank = process_rank - self.num_processes = num_processes - # Tokenizer IDs - self.cls_token_id = tokenizer.cls_token_id - self.eos_token_id = tokenizer.eos_token_id - self.pad_token_id = tokenizer.pad_token_id - self.mask_token_id = tokenizer.mask_token_id - self.special_tokens = [self.cls_token_id, self.eos_token_id, self.pad_token_id] - - # All processes load all files (since we're distributing by sequences, not files) - self.all_files = sorted(Path.cwd().glob(filename_pattern)) - if not self.all_files: - raise ValueError(f"No files found matching pattern: {filename_pattern}") - - def __iter__(self): - """Generate batches, with each process taking every num_processes-th batch.""" - batch_count = 0 - - for file in self.all_files: - raw_tokens = _load_data_shard(file) - - # Process the tokens into batches - eos_positions = (raw_tokens == self.eos_token_id).nonzero(as_tuple=True)[0] - - if len(eos_positions) == 0: - continue - - # Process samples and create batches - batch_tokens = [] - curr_batch_len = 0 - - for i in range(len(eos_positions)): - curr_eos = eos_positions[i] - prev_eos_plus_one = 0 if i == 0 else eos_positions[i-1] + 1 - sample = raw_tokens[prev_eos_plus_one:curr_eos+1] - - # Handle samples that exceed batch size - if len(sample) > self.seq_len: - # Split large samples into multiple batches - for j in range(0, len(sample), self.seq_len): - chunk = sample[j:j+self.seq_len] - if len(chunk) < self.seq_len: - # Pad the last chunk - padding = torch.full((self.seq_len - len(chunk),), self.pad_token_id, dtype=torch.uint8) - chunk = torch.cat([chunk, padding]) - - # Check if this batch should be yielded by this process - if batch_count % self.num_processes == self.process_rank: - # Apply masking and yield batch - input_ids, labels, mask_rate = self._apply_masking(chunk) - yield input_ids, labels, mask_rate - batch_count += 1 - continue - - # Check if adding this sample would exceed batch size - if len(sample) + curr_batch_len > self.seq_len: - # Pad current batch and yield - if curr_batch_len > 0: - padding = torch.full((self.seq_len - curr_batch_len,), self.pad_token_id, dtype=torch.uint8) - batch_tokens.append(padding) - batch = torch.cat(batch_tokens) - - # Check if this batch should be yielded by this process - if batch_count % self.num_processes == self.process_rank: - # Apply masking and yield - input_ids, labels, mask_rate = self._apply_masking(batch) - yield input_ids, labels, mask_rate - batch_count += 1 - - # Start new batch - batch_tokens = [sample] - curr_batch_len = len(sample) - else: - # Add to current batch - batch_tokens.append(sample) - curr_batch_len += len(sample) - - # Yield complete batch - if curr_batch_len == self.seq_len: - batch = torch.cat(batch_tokens) - - # Check if this batch should be yielded by this process - if batch_count % self.num_processes == self.process_rank: - input_ids, labels, mask_rate = self._apply_masking(batch) - yield input_ids, labels, mask_rate - batch_count += 1 - batch_tokens = [] - curr_batch_len = 0 - - # Yield final incomplete batch if it exists - if curr_batch_len > 0: - padding = torch.full((self.seq_len - curr_batch_len,), self.pad_token_id, dtype=torch.uint8) - batch_tokens.append(padding) - batch = torch.cat(batch_tokens) - - # Check if this batch should be yielded by this process - if batch_count % self.num_processes == self.process_rank: - input_ids, labels, mask_rate = self._apply_masking(batch) - yield input_ids, labels, mask_rate - batch_count += 1 - - def _apply_masking(self, sequence: torch.Tensor) -> Tuple[torch.Tensor, torch.Tensor, torch.Tensor]: - """Apply masking to a sequence (on CPU).""" - # Convert to int32 - sequence = sequence.to(dtype=torch.int32) - - # Use fixed mask rate for evaluation - mask_rate = torch.full((1,), 0.15) - - # Create mask - p_mask = mask_rate.repeat(len(sequence)) - mask_indices = torch.rand(len(sequence)) < p_mask - - # Don't mask special tokens - special_mask = torch.isin(sequence, torch.tensor(self.special_tokens, dtype=torch.int32)) - mask_indices = mask_indices & ~special_mask - - # Create noisy batch and labels - noisy_batch = torch.where(mask_indices, self.mask_token_id, sequence) - labels = sequence.clone() - labels[~mask_indices] = -100 - - return noisy_batch, labels, mask_rate - - -class OptimizedEvalLoader: - """Drop-in replacement for evaluation that distributes data by sequences rather than files.""" - - def __init__( - self, - filename_pattern: str, - seq_len: int, - process_rank: int, - num_processes: int, - tokenizer: EsmTokenizer, - ): - self.filename_pattern = filename_pattern - self.seq_len = seq_len - self.process_rank = process_rank - self.num_processes = num_processes - - # Create the dataset - self._dataset = EvalLoader( - filename_pattern=filename_pattern, - seq_len=seq_len, - process_rank=process_rank, - num_processes=num_processes, - tokenizer=tokenizer, - ) - - # Store file list for compatibility - all processes see all files - self.files = self._dataset.all_files - - # Create the dataloader (single worker for evaluation to ensure deterministic order) - self.dataloader = DataLoader( - self._dataset, - batch_size=None, # Dataset returns complete batches - num_workers=0, # Single worker for deterministic eval order - pin_memory=True, # Pin memory for faster GPU transfer - ) - - # Create iterator - self._iterator = None - self._exhausted = False - - def reset(self): - """Reset the dataloader iterator.""" - self._iterator = iter(self.dataloader) - self._exhausted = False - - def next_batch(self) -> Tuple[torch.Tensor, torch.Tensor, torch.Tensor]: - """Get the next batch, ensuring GPU transfer happens here.""" - if self._iterator is None: - self.reset() - - try: - input_ids, labels, mask_rate = next(self._iterator) - # Transfer to GPU with non-blocking - input_ids = input_ids.cuda(non_blocking=True) - labels = labels.cuda(non_blocking=True) - mask_rate = mask_rate.cuda(non_blocking=True) - return input_ids, labels, mask_rate - except StopIteration: - self._exhausted = True - # Return empty tensors to signal end of data - return torch.empty(0, device='cuda'), torch.empty(0, device='cuda'), torch.empty(0, device='cuda') - - -class TrainLoader(IterableDataset): - """An IterableDataset that handles distributed padded data loading with masking.""" - - def __init__( - self, - filename_pattern: str, - seq_len: int, - process_rank: int, - num_processes: int, - max_epochs: int, - tokenizer: EsmTokenizer, - num_workers: int = 1, - mlm: bool = False, - mask_rate: float = 0.15, - ): - self.filename_pattern = filename_pattern - self.seq_len = seq_len - self.process_rank = process_rank - self.num_processes = num_processes - self.max_epochs = max_epochs - self.num_workers = num_workers - self.mask_rate = mask_rate - # Tokenizer IDs - self.cls_token_id = tokenizer.cls_token_id - self.eos_token_id = tokenizer.eos_token_id - self.pad_token_id = tokenizer.pad_token_id - self.mask_token_id = tokenizer.mask_token_id - self.special_tokens = [self.cls_token_id, self.eos_token_id, self.pad_token_id] - self.mlm = mlm - # Get all files and distribute across processes (GPUs) - all_files = sorted(Path.cwd().glob(filename_pattern)) - if not all_files: - raise ValueError(f"No files found matching pattern: {filename_pattern}") - - # First distribute files across processes (GPUs) - files_per_process = len(all_files) // self.num_processes - extra_files = len(all_files) % self.num_processes - - start_idx = self.process_rank * files_per_process + min(self.process_rank, extra_files) - end_idx = start_idx + files_per_process + (1 if self.process_rank < extra_files else 0) - - self.process_files = all_files[start_idx:end_idx] - - def __iter__(self): - worker_info = data.get_worker_info() - if worker_info is None: - # Single worker mode - worker_id = 0 - num_workers = 1 - else: - worker_id = worker_info.id - num_workers = worker_info.num_workers - - # Then distribute this process's files across workers - files_per_worker = len(self.process_files) // num_workers - extra_files = len(self.process_files) % num_workers - - start_idx = worker_id * files_per_worker + min(worker_id, extra_files) - end_idx = start_idx + files_per_worker + (1 if worker_id < extra_files else 0) - - worker_files = self.process_files[start_idx:end_idx] - - # Process files cyclically for multiple epochs - epoch = 0 - file_idx = 0 - leftover_tokens = torch.empty(0, dtype=torch.uint8) - - while epoch < self.max_epochs: - # Shuffle files at the start of each epoch - if file_idx == 0 and epoch > 0: - # Include process rank for proper distributed shuffling - random.seed(epoch + self.process_rank * 10000 + worker_id * 1000) - random.shuffle(worker_files) - - # Load current file - if file_idx < len(worker_files): - raw_tokens = _load_data_shard(worker_files[file_idx]) - raw_tokens = torch.cat([leftover_tokens, raw_tokens], dim=0) - file_idx += 1 - else: - # End of epoch - if leftover_tokens.numel() == 0: - epoch += 1 - file_idx = 0 - continue - raw_tokens = leftover_tokens - leftover_tokens = torch.empty(0, dtype=torch.uint8) - - # Process the tokens into batches - eos_positions = (raw_tokens == self.eos_token_id).nonzero(as_tuple=True)[0] - - if len(eos_positions) == 0: - leftover_tokens = raw_tokens - if file_idx >= len(worker_files): - epoch += 1 - file_idx = 0 - continue - - # Process samples and create batches - batch_tokens = [] - curr_batch_len = 0 - - for i in range(len(eos_positions)): - curr_eos = eos_positions[i] - prev_eos_plus_one = 0 if i == 0 else eos_positions[i-1] + 1 - sample = raw_tokens[prev_eos_plus_one:curr_eos+1] - - # Handle samples that exceed batch size - if len(sample) > self.seq_len: - # Split large samples into multiple batches - for j in range(0, len(sample), self.seq_len): - chunk = sample[j:j+self.seq_len] - if len(chunk) < self.seq_len: - # Pad the last chunk - padding = torch.full((self.seq_len - len(chunk),), self.pad_token_id, dtype=torch.uint8) - chunk = torch.cat([chunk, padding]) - - # Apply masking and yield batch - input_ids, labels, mask_rate = self._apply_masking(chunk) - yield input_ids, labels, mask_rate - continue - - # Check if adding this sample would exceed batch size - if len(sample) + curr_batch_len > self.seq_len: - # Pad current batch and yield - if curr_batch_len > 0: - padding = torch.full((self.seq_len - curr_batch_len,), self.pad_token_id, dtype=torch.uint8) - batch_tokens.append(padding) - batch = torch.cat(batch_tokens) - - # Apply masking and yield - input_ids, labels, mask_rate = self._apply_masking(batch) - yield input_ids, labels, mask_rate - - # Start new batch - batch_tokens = [sample] - curr_batch_len = len(sample) - else: - # Add to current batch - batch_tokens.append(sample) - curr_batch_len += len(sample) - - # Yield complete batch - if curr_batch_len == self.seq_len: - batch = torch.cat(batch_tokens) - input_ids, labels, mask_rate = self._apply_masking(batch) - yield input_ids, labels, mask_rate - batch_tokens = [] - curr_batch_len = 0 - - # Save leftover tokens for next file - if len(eos_positions) > 0: - leftover_tokens = raw_tokens[eos_positions[-1]+1:] - - # Yield final incomplete batch if at end of epoch - if file_idx >= len(worker_files) and curr_batch_len > 0: - padding = torch.full((self.seq_len - curr_batch_len,), self.pad_token_id, dtype=torch.uint8) - batch_tokens.append(padding) - batch = torch.cat(batch_tokens) - input_ids, labels, mask_rate = self._apply_masking(batch) - yield input_ids, labels, mask_rate - - epoch += 1 - file_idx = 0 - - def _apply_masking(self, sequence: torch.Tensor) -> Tuple[torch.Tensor, torch.Tensor, torch.Tensor]: - """Apply masking to a sequence (on CPU).""" - # Convert to int32 - sequence = sequence.to(dtype=torch.int32) - - # Pick mask rate - if self.mlm: - mask_rate = torch.full((1,), self.mask_rate) - else: - eps = 1e-3 - mask_rate = torch.rand(1) - mask_rate = (1 - eps) * mask_rate + eps - - # Create mask - p_mask = mask_rate.repeat(len(sequence)) - mask_indices = torch.rand(len(sequence)) < p_mask - - # Don't mask special tokens - special_mask = torch.isin(sequence, torch.tensor(self.special_tokens, dtype=torch.int32)) - mask_indices = mask_indices & ~special_mask - - # Create noisy batch and labels - noisy_batch = torch.where(mask_indices, self.mask_token_id, sequence) - labels = sequence.clone() - labels[~mask_indices] = -100 - - return noisy_batch, labels, mask_rate - - -class OptimizedTrainLoader: - """Drop-in replacement for DistributedPaddedDataLoader using multi-worker optimization.""" - - def __init__( - self, - filename_pattern: str, - seq_len: int, - process_rank: int, - num_processes: int, - max_epochs: int, - tokenizer: EsmTokenizer, - num_workers: int = 4, - prefetch_factor: int = 2, - mlm: bool = False, - mask_rate: float = 0.15, - ): - self.filename_pattern = filename_pattern - self.seq_len = seq_len - self.process_rank = process_rank - self.num_processes = num_processes - self.mlm = mlm - self.mask_rate = mask_rate - - # Create the dataset to get file count - self._dataset = TrainLoader( - filename_pattern=filename_pattern, - seq_len=seq_len, - process_rank=process_rank, - num_processes=num_processes, - max_epochs=max_epochs, - tokenizer=tokenizer, - num_workers=num_workers, - mlm=mlm, - mask_rate=mask_rate, - ) - - # Store file list for compatibility - only this process's files - self.files = self._dataset.process_files - - # Create the optimized dataloader - self.dataloader = DataLoader( - self._dataset, - batch_size=None, # Dataset returns complete batches - num_workers=num_workers, - pin_memory=True, # Pin memory for faster GPU transfer - prefetch_factor=prefetch_factor if num_workers > 0 else None, - persistent_workers=True if num_workers > 0 else False, # Keep workers alive between epochs - ) - - # Create iterator - self._iterator = None - self._exhausted = False - - def set_mask_rate(self, mask_rate: float): - """Set the mask rate for the next batch(es).""" - self.mask_rate = mask_rate - self._dataset.mask_rate = mask_rate - - def set_mlm(self, mlm: bool): - """Set whether to use MLM masking in the dataset.""" - self.mlm = mlm - self._dataset.mlm = mlm - - def reset(self): - """Reset the dataloader iterator.""" - self._iterator = iter(self.dataloader) - self._exhausted = False - - def next_batch(self) -> Tuple[torch.Tensor, torch.Tensor, torch.Tensor]: - """Get the next batch, ensuring GPU transfer happens here.""" - if self._iterator is None: - self.reset() - - try: - input_ids, labels, mask_rate = next(self._iterator) - # Transfer to GPU with non-blocking - input_ids = input_ids.cuda(non_blocking=True) - labels = labels.cuda(non_blocking=True) - mask_rate = mask_rate.cuda(non_blocking=True) - return input_ids, labels, mask_rate - except StopIteration: - self._exhausted = True - # Return empty tensors to signal end of data - return torch.empty(0, device='cuda'), torch.empty(0, device='cuda'), torch.empty(0, device='cuda') - - -# ======================================================================================== -# Chunk-aligned data loaders (new for batched UNet + GPU-side masking) -# ======================================================================================== - - -class ChunkedTrainDataset(IterableDataset): - """Chunk-aligned IterableDataset that packs documents into fixed-length chunks. - - Each chunk is exactly max_length tokens with documents packed end-to-end. - No document spans a chunk boundary. If a document doesn't fit in the current - chunk, the remainder is padded and a new chunk starts. Documents exceeding - max_length are truncated to their own chunk. - - Yields batches of (B, max_length) int32 tensors containing raw input_ids - (no masking applied -- masking is done on GPU in the training loop). - """ - - def __init__( - self, - filename_pattern: str, - max_length: int, - batch_size: int, - process_rank: int, - num_processes: int, - max_epochs: int, - tokenizer: EsmTokenizer, - num_workers: int = 1, - ): - self.filename_pattern = filename_pattern - self.max_length = max_length - self.batch_size = batch_size - self.process_rank = process_rank - self.num_processes = num_processes - self.max_epochs = max_epochs - self.num_workers = num_workers - self.cls_token_id = tokenizer.cls_token_id - self.eos_token_id = tokenizer.eos_token_id - self.pad_token_id = tokenizer.pad_token_id - - all_files = sorted(Path.cwd().glob(filename_pattern)) - assert len(all_files) > 0, f"No files found matching pattern: {filename_pattern}" - - # Distribute files across processes (GPUs) - files_per_process = len(all_files) // num_processes - extra = len(all_files) % num_processes - start = process_rank * files_per_process + min(process_rank, extra) - end = start + files_per_process + (1 if process_rank < extra else 0) - self.process_files = all_files[start:end] - - def _pack_chunks(self, raw_tokens: torch.Tensor): - """Pack raw tokens into max_length-aligned chunks. - - Documents are delineated by EOS tokens. Each chunk contains one or more - complete documents, padded at the end if needed. - - Yields individual (max_length,) uint8 chunks. - """ - eos_positions = (raw_tokens == self.eos_token_id).nonzero(as_tuple=True)[0] - if len(eos_positions) == 0: - return - - chunk_parts: List[torch.Tensor] = [] - chunk_len = 0 - - prev_start = 0 - for i in range(len(eos_positions)): - curr_eos = eos_positions[i].item() - doc = raw_tokens[prev_start:curr_eos + 1] - prev_start = curr_eos + 1 - doc_len = len(doc) - - if doc_len > self.max_length: - # Flush current chunk if it has data - if chunk_len > 0: - padding = torch.full((self.max_length - chunk_len,), self.pad_token_id, dtype=torch.uint8) - yield torch.cat(chunk_parts + [padding]) - chunk_parts = [] - chunk_len = 0 - # Truncate oversized document to its own chunk - yield doc[:self.max_length].clone() - continue - - if doc_len + chunk_len > self.max_length: - # Doc doesn't fit: pad and yield current chunk - padding = torch.full((self.max_length - chunk_len,), self.pad_token_id, dtype=torch.uint8) - yield torch.cat(chunk_parts + [padding]) - chunk_parts = [] - chunk_len = 0 - - chunk_parts.append(doc) - chunk_len += doc_len - - if chunk_len == self.max_length: - yield torch.cat(chunk_parts) - chunk_parts = [] - chunk_len = 0 - - # Yield remaining chunk if any - if chunk_len > 0: - padding = torch.full((self.max_length - chunk_len,), self.pad_token_id, dtype=torch.uint8) - yield torch.cat(chunk_parts + [padding]) - - def __iter__(self): - worker_info = data.get_worker_info() - if worker_info is None: - worker_id = 0 - num_workers = 1 - else: - worker_id = worker_info.id - num_workers = worker_info.num_workers - - # Distribute this process's files across workers - files_per_worker = len(self.process_files) // num_workers - extra = len(self.process_files) % num_workers - start = worker_id * files_per_worker + min(worker_id, extra) - end = start + files_per_worker + (1 if worker_id < extra else 0) - worker_files = list(self.process_files[start:end]) - - epoch = 0 - leftover_tokens = torch.empty(0, dtype=torch.uint8) - batch_chunks: List[torch.Tensor] = [] - - while epoch < self.max_epochs: - file_idx = 0 - - if epoch > 0: - random.seed(epoch + self.process_rank * 10000 + worker_id * 1000) - random.shuffle(worker_files) - - while file_idx < len(worker_files): - raw_tokens = _load_data_shard(worker_files[file_idx]) - raw_tokens = torch.cat([leftover_tokens, raw_tokens]) - file_idx += 1 - - # Find last complete document - eos_positions = (raw_tokens == self.eos_token_id).nonzero(as_tuple=True)[0] - if len(eos_positions) == 0: - leftover_tokens = raw_tokens - continue - - last_eos_pos = eos_positions[-1].item() - leftover_tokens = raw_tokens[last_eos_pos + 1:] - complete_tokens = raw_tokens[:last_eos_pos + 1] - - for chunk in self._pack_chunks(complete_tokens): - batch_chunks.append(chunk.to(torch.int32)) - if len(batch_chunks) == self.batch_size: - yield torch.stack(batch_chunks) # (B, max_length) - batch_chunks = [] - - # End of epoch: drop incomplete batch, reset - leftover_tokens = torch.empty(0, dtype=torch.uint8) - batch_chunks = [] - epoch += 1 - - -class ChunkedTrainLoader: - """Chunk-aligned training data loader. - - Yields (B, max_length) int32 tensors of raw input_ids on CPU (pinned memory). - No masking applied -- masking is handled on GPU in the training loop. - """ - - def __init__( - self, - filename_pattern: str, - max_length: int, - micro_batch_tokens: int, - process_rank: int, - num_processes: int, - max_epochs: int, - tokenizer: EsmTokenizer, - num_workers: int = 4, - prefetch_factor: int = 2, - ): - self.max_length = max_length - batch_size = micro_batch_tokens // max_length - assert batch_size >= 1, f"micro_batch_tokens ({micro_batch_tokens}) must be >= max_length ({max_length})" - - self._dataset = ChunkedTrainDataset( - filename_pattern=filename_pattern, - max_length=max_length, - batch_size=batch_size, - process_rank=process_rank, - num_processes=num_processes, - max_epochs=max_epochs, - tokenizer=tokenizer, - num_workers=num_workers, - ) - self.files = self._dataset.process_files - - self.dataloader = DataLoader( - self._dataset, - batch_size=None, - num_workers=num_workers, - pin_memory=True, - prefetch_factor=prefetch_factor if num_workers > 0 else None, - persistent_workers=True if num_workers > 0 else False, - ) - self._iterator = None - self._exhausted = False - - def reset(self): - """Reset the dataloader iterator.""" - self._iterator = iter(self.dataloader) - self._exhausted = False - - def next_batch(self) -> torch.Tensor: - """Get next batch of raw input_ids (B, max_length) on CPU (pinned memory).""" - if self._iterator is None: - self.reset() - - try: - return next(self._iterator) - except StopIteration: - self._exhausted = True - return torch.empty(0, dtype=torch.int32) - - -class ChunkedEvalDataset(IterableDataset): - """Chunk-aligned evaluation dataset. Same packing as training but: - - All processes see all files (distributes by sequence, not file) - - Single epoch only - - Yields (B, max_length) int32 raw input_ids - """ - - def __init__( - self, - filename_pattern: str, - max_length: int, - batch_size: int, - process_rank: int, - num_processes: int, - tokenizer: EsmTokenizer, - ): - self.filename_pattern = filename_pattern - self.max_length = max_length - self.batch_size = batch_size - self.process_rank = process_rank - self.num_processes = num_processes - self.eos_token_id = tokenizer.eos_token_id - self.pad_token_id = tokenizer.pad_token_id - - self.all_files = sorted(Path.cwd().glob(filename_pattern)) - assert len(self.all_files) > 0, f"No files found matching pattern: {filename_pattern}" - - def __iter__(self): - """Generate batches, with each process taking every num_processes-th batch.""" - batch_count = 0 - batch_chunks: List[torch.Tensor] = [] - - for file in self.all_files: - raw_tokens = _load_data_shard(file) - - eos_positions = (raw_tokens == self.eos_token_id).nonzero(as_tuple=True)[0] - if len(eos_positions) == 0: - continue - - chunk_parts: List[torch.Tensor] = [] - chunk_len = 0 - prev_start = 0 - - for i in range(len(eos_positions)): - curr_eos = eos_positions[i].item() - doc = raw_tokens[prev_start:curr_eos + 1] - prev_start = curr_eos + 1 - doc_len = len(doc) - - if doc_len > self.max_length: - if chunk_len > 0: - padding = torch.full((self.max_length - chunk_len,), self.pad_token_id, dtype=torch.uint8) - batch_chunks.append(torch.cat(chunk_parts + [padding]).to(torch.int32)) - chunk_parts = [] - chunk_len = 0 - if len(batch_chunks) == self.batch_size: - if batch_count % self.num_processes == self.process_rank: - yield torch.stack(batch_chunks) - batch_count += 1 - batch_chunks = [] - batch_chunks.append(doc[:self.max_length].clone().to(torch.int32)) - if len(batch_chunks) == self.batch_size: - if batch_count % self.num_processes == self.process_rank: - yield torch.stack(batch_chunks) - batch_count += 1 - batch_chunks = [] - continue - - if doc_len + chunk_len > self.max_length: - padding = torch.full((self.max_length - chunk_len,), self.pad_token_id, dtype=torch.uint8) - batch_chunks.append(torch.cat(chunk_parts + [padding]).to(torch.int32)) - chunk_parts = [] - chunk_len = 0 - if len(batch_chunks) == self.batch_size: - if batch_count % self.num_processes == self.process_rank: - yield torch.stack(batch_chunks) - batch_count += 1 - batch_chunks = [] - - chunk_parts.append(doc) - chunk_len += doc_len - - if chunk_len == self.max_length: - batch_chunks.append(torch.cat(chunk_parts).to(torch.int32)) - chunk_parts = [] - chunk_len = 0 - if len(batch_chunks) == self.batch_size: - if batch_count % self.num_processes == self.process_rank: - yield torch.stack(batch_chunks) - batch_count += 1 - batch_chunks = [] - - # Flush remaining chunk from this file - if chunk_len > 0: - padding = torch.full((self.max_length - chunk_len,), self.pad_token_id, dtype=torch.uint8) - batch_chunks.append(torch.cat(chunk_parts + [padding]).to(torch.int32)) - if len(batch_chunks) == self.batch_size: - if batch_count % self.num_processes == self.process_rank: - yield torch.stack(batch_chunks) - batch_count += 1 - batch_chunks = [] - - # Drop partial batches to maintain fixed (B, max_length) shape - - -class ChunkedEvalLoader: - """Chunk-aligned evaluation loader. - - Yields (B, max_length) int32 tensors of raw input_ids on CPU. - Distributes data by sequence across processes. - """ - - def __init__( - self, - filename_pattern: str, - max_length: int, - micro_batch_tokens: int, - process_rank: int, - num_processes: int, - tokenizer: EsmTokenizer, - ): - self.max_length = max_length - batch_size = micro_batch_tokens // max_length - assert batch_size >= 1, f"micro_batch_tokens ({micro_batch_tokens}) must be >= max_length ({max_length})" - - self._dataset = ChunkedEvalDataset( - filename_pattern=filename_pattern, - max_length=max_length, - batch_size=batch_size, - process_rank=process_rank, - num_processes=num_processes, - tokenizer=tokenizer, - ) - self.files = self._dataset.all_files - - self.dataloader = DataLoader( - self._dataset, - batch_size=None, - num_workers=0, - pin_memory=True, - ) - self._iterator = None - self._exhausted = False - - def reset(self): - """Reset the dataloader iterator.""" - self._iterator = iter(self.dataloader) - self._exhausted = False - - def next_batch(self) -> torch.Tensor: - """Get next batch of raw input_ids (B, max_length) on CPU.""" - if self._iterator is None: - self.reset() - - try: - return next(self._iterator) - except StopIteration: - self._exhausted = True - return torch.empty(0, dtype=torch.int32) - - -def apply_masking_gpu( - input_ids: torch.Tensor, - special_tokens: torch.Tensor, - mask_token_id: int, - mask_rate: float, - mlm: bool = False, -): - """Apply masking on GPU -- much faster than CPU, no worker sync issues. - - Args: - input_ids: (B, L) or (L,) raw token IDs on GPU - special_tokens: 1D tensor of token IDs to never mask (CLS, EOS, PAD) - mask_token_id: Token ID to replace masked positions with - mask_rate: Maximum mask rate (for MLM, used directly; for MD, sampled uniformly) - mlm: If True, use fixed mask_rate. If False, sample uniform rate (masked diffusion). - - Returns: - noisy: input_ids with masked positions replaced by mask_token_id - labels: original token IDs at masked positions, -100 elsewhere - rate: scalar tensor of the actual mask rate used - """ - if mlm: - rate = torch.tensor(mask_rate, device=input_ids.device, dtype=torch.float32) - else: - eps = 1e-3 - rate = torch.rand(1, device=input_ids.device) * (1 - eps) + eps - - mask_probs = torch.rand_like(input_ids, dtype=torch.float32) - mask_indices = mask_probs < rate - - # Don't mask special tokens - special_mask = torch.isin(input_ids, special_tokens) - mask_indices = mask_indices & ~special_mask - - labels = input_ids.clone() - labels[~mask_indices] = -100 - noisy = torch.where(mask_indices, mask_token_id, input_ids) - return noisy, labels, rate - - -class AsyncBatchPipeline: - """Double-buffered CUDA stream pipeline for overlapping H2D transfer with compute. - - Wraps a data loader that yields CPU tensors. Uses a background CUDA stream - to transfer the next batch while the current batch is being processed on - the default stream. - """ - - def __init__(self, loader): - """ - Args: - loader: A data loader with .next_batch() returning CPU tensors - and ._exhausted attribute. - """ - self.loader = loader - self.files = loader.files - self.transfer_stream = torch.cuda.Stream() - self._next_batch = None - self._exhausted = False - - def reset(self): - """Reset the underlying loader and pre-fetch the first batch.""" - self.loader.reset() - self._exhausted = False - self._next_batch = None - self._prefetch() - - def _prefetch(self): - """Transfer the next batch to GPU on the background stream.""" - raw = self.loader.next_batch() - if raw.numel() == 0: - self._exhausted = True - self._next_batch = None - return - with torch.cuda.stream(self.transfer_stream): - self._next_batch = raw.cuda(non_blocking=True) - - def next_batch(self) -> torch.Tensor: - """Return the pre-staged GPU batch and start transferring the next one. - - Returns: - input_ids on GPU (B, max_length) int32, or empty tensor if exhausted. - """ - if self._next_batch is None: - if self._exhausted: - return torch.empty(0, dtype=torch.int32, device='cuda') - self._prefetch() - if self._next_batch is None: - return torch.empty(0, dtype=torch.int32, device='cuda') - - # Wait for the transfer to complete - torch.cuda.current_stream().wait_stream(self.transfer_stream) - batch = self._next_batch - - # Start prefetching the next batch - self._prefetch() - - return batch +from speedrunning_plms.data.loaders import * # noqa: F401,F403 diff --git a/data/download_data.py b/data/download_data.py index 03e1ea9c9..ed3cb697c 100644 --- a/data/download_data.py +++ b/data/download_data.py @@ -1,28 +1,13 @@ -import os -import argparse -from huggingface_hub import hf_hub_download +import sys +from pathlib import Path +_SRC = Path(__file__).resolve().parents[1] / "src" +if str(_SRC) not in sys.path: + sys.path.insert(0, str(_SRC)) -### Download the data from huggingface -def get(fname, data_name): - local_dir = os.path.join(os.path.dirname(__file__), data_name) - if not os.path.exists(os.path.join(local_dir, fname)): - try: - print(f"Downloading {fname} from Synthyra/{data_name}_packed") - hf_hub_download(repo_id=f"Synthyra/{data_name}_packed", filename=fname, repo_type="dataset", local_dir=local_dir) - except Exception as e: - print(f"Error downloading {fname}: {e}") - else: - print(f"File {fname} already exists in {local_dir}") +from speedrunning_plms.data.download import * # noqa: F401,F403 +from speedrunning_plms.data.download import main if __name__ == "__main__": - parser = argparse.ArgumentParser(description="Download data from huggingface") - parser.add_argument("-d", "--data_name", type=str, default="uniref50", help="Name of the dataset, uniref50, omg_prot50, or og_prot90") - parser.add_argument("-n", "--num_chunks", type=int, default=100, help="Number of chunks to download") - # each chunk is 100M tokens - args = parser.parse_args() - get(f"{args.data_name}_valid_%06d.bin" % 0, args.data_name) - get(f"{args.data_name}_test_%06d.bin" % 0, args.data_name) - for i in range(0, args.num_chunks+1): - get(f"{args.data_name}_train_%06d.bin" % i, args.data_name) \ No newline at end of file + main() diff --git a/data/tokenize_data.py b/data/tokenize_data.py index 6716390a9..ea0ba4dc5 100644 --- a/data/tokenize_data.py +++ b/data/tokenize_data.py @@ -1,209 +1,13 @@ -""" -example doc to highlight the structure of the dataset: -{ - "sequence": "MYDSNIFEKVNQYKFLYIWWLIMINVNH" -} -""" -import os -import argparse -import multiprocessing as mp -import numpy as np -import glob -from functools import partial -from transformers import EsmTokenizer -from datasets import load_dataset -from tqdm import tqdm +import sys +from pathlib import Path +_SRC = Path(__file__).resolve().parents[1] / "src" +if str(_SRC) not in sys.path: + sys.path.insert(0, str(_SRC)) -def upload_folder_to_hf(folder_path, repo_id, repo_type="dataset", token=None): - """ - Upload an entire folder to Hugging Face Hub (bulk upload to avoid rate limiting) - - Benefits: - - Uploads all files in a single operation instead of individual requests - - Automatically handles large uploads with multi-commit strategy - - Reduces API rate limiting issues - - More efficient for large numbers of files - """ - if repo_id is None: - print(f"Skipping upload for {folder_path} - no repo_id specified") - return - - try: - from huggingface_hub import HfApi - api = HfApi() - - print(f"Uploading folder {folder_path} to {repo_id}...") - - # Create repository if it doesn't exist - try: - api.create_repo( - repo_id=repo_id, - repo_type=repo_type, - token=token, - exist_ok=True - ) - print(f"Repository {repo_id} ready") - except Exception as e: - print(f"Repository might already exist: {e}") - - # Count files to upload - file_count = len([f for f in os.listdir(folder_path) if f.endswith('.bin')]) - print(f"Found {file_count} files to upload") - - # Try to use multi_commits for large uploads (if supported) - try: - if file_count > 100: # Use multi-commit for large uploads - print("Using multi-commit upload for large number of files...") - api.upload_folder( - folder_path=folder_path, - repo_id=repo_id, - repo_type=repo_type, - token=token, - multi_commits=True, - multi_commits_verbose=True - ) - else: - # Standard upload for smaller sets - api.upload_folder( - folder_path=folder_path, - repo_id=repo_id, - repo_type=repo_type, - token=token - ) - except TypeError as e: - if "multi_commits" in str(e): - print("multi_commits not supported in this version of huggingface_hub, using standard upload...") - # Fall back to standard upload - api.upload_folder( - folder_path=folder_path, - repo_id=repo_id, - repo_type=repo_type, - token=token - ) - else: - raise e - - print(f"Successfully uploaded folder {folder_path} to {repo_id}") - - except Exception as e: - print(f"Error uploading folder {folder_path}: {e}") - - -def write_datafile(filename, toks): - """ - Saves token data as a .bin file, for reading in C. - - First comes a header with 256 int32s - - The tokens follow, each as a uint8 - """ - assert len(toks) < 2**31, "token count too large" # ~2.1B tokens - # construct the header - header = np.zeros(256, dtype=np.int32) - header[0] = 20240520 # magic - header[1] = 1 # version - header[2] = len(toks) # number of tokens after the 256*4 bytes of header (each 1 byte as uint8) - # construct the tokens numpy array, if not already - print(f"\nwriting {len(toks):,} tokens to {filename}") - with open(filename, "wb") as f: - f.write(header.tobytes()) - f.write(toks.tobytes()) - - -def tokenize(doc, tokenizer, max_length): - # tokenizes a single document and returns a numpy array of uint8 tokens - # uint8 can hold the 33 tokens - return np.array(tokenizer.encode(doc["sequence"], add_special_tokens=True, truncation=True, padding=False, max_length=max_length), dtype=np.uint8) - - -def tokenize_fw(fw, split='train', data_name='omgprot50', max_length=1024, upload_repo=None, token=None): - # tokenize all documents and write output shards, each of approximately shard_size tokens - # ensures each shard contains complete sequences only - - # Check if .bin files already exist for this dataset/split - existing_files = glob.glob(os.path.join(DATA_CACHE_DIR, f"{data_name}_{split}_*.bin")) - - if existing_files: - print(f"Found {len(existing_files)} existing .bin files for {data_name}_{split}") - print("Skipping tokenization and proceeding to upload...") - - # Upload existing files if upload_repo is specified - if upload_repo: - upload_folder_to_hf(DATA_CACHE_DIR, upload_repo, token=token) - else: - print("No upload repository specified, files are ready locally") - return - - print(f"No existing .bin files found for {data_name}_{split}, proceeding with tokenization...") - - tokenizer = EsmTokenizer.from_pretrained("facebook/esm2_t6_8M_UR50D") - nprocs = max(1, os.cpu_count() - 2) # don't hog the entire system - with mp.Pool(nprocs) as pool: - shard_index = 0 - current_shard = [] - current_size = 0 - progress_bar = None - tokenize_fn = partial(tokenize, tokenizer=tokenizer, max_length=max_length) - - for tokens in pool.imap(tokenize_fn, fw, chunksize=16): - # Update progress bar - if progress_bar is None: - progress_bar = tqdm(total=args.shard_size, unit="tokens", desc=f"Shard {shard_index}") - - # If adding this sequence would exceed shard size, write current shard and start new one - if current_size + len(tokens) > args.shard_size and current_size > 0: - # Convert accumulated tokens to numpy array and write - all_tokens_np = np.concatenate(current_shard) - filename = os.path.join(DATA_CACHE_DIR, f"{data_name}_{split}_{shard_index:06d}.bin") - write_datafile(filename, all_tokens_np) - - # Reset for next shard - shard_index += 1 - current_shard = [] - current_size = 0 - progress_bar = None - - # Add sequence to current shard - current_shard.append(tokens) - current_size += len(tokens) - if progress_bar: - progress_bar.update(len(tokens)) - - # Write final shard if there are remaining sequences - if current_size > 0: - all_tokens_np = np.concatenate(current_shard) - filename = os.path.join(DATA_CACHE_DIR, f"{data_name}_{split}_{shard_index:06d}.bin") - write_datafile(filename, all_tokens_np) - - # Upload all files at once after tokenization is complete - if upload_repo: - upload_folder_to_hf(DATA_CACHE_DIR, upload_repo, token=token) - - -parser = argparse.ArgumentParser(description="OMGprot50 dataset preprocessing") -parser.add_argument("-s", "--shard_size", type=int, default=10**8, help="Size of each shard in tokens") -parser.add_argument("-m", "--max_length", type=int, default=1024, help="Maximum sequence length") -parser.add_argument("-d", "--data_name", type=str, default="omg_prot50", help="Name of the dataset") -parser.add_argument("-r", "--upload_repo", type=str, default=None, help="Hugging Face repository ID to upload to (e.g., 'username/repo_name')") -parser.add_argument("-t", "--hf_token", type=str, default=None, help="Hugging Face token for authentication (or set token environment variable)") +from speedrunning_plms.data.tokenize import * # noqa: F401,F403 +from speedrunning_plms.data.tokenize import main if __name__ == "__main__": - args = parser.parse_args() - data_name = args.data_name - - # Get HF token from args or environment - token = args.hf_token or os.environ.get("token") - if args.upload_repo and not token: - print("Warning: Upload repository specified but no HF token provided. Set --hf_token or token environment variable.") - - # create the cache the local directory if it doesn't exist yet - DATA_CACHE_DIR = os.path.join(os.path.dirname(__file__), data_name) - os.makedirs(DATA_CACHE_DIR, exist_ok=True) - - # download the dataset - train_fw = load_dataset(f"Synthyra/{data_name}", split="train") - valid_fw = load_dataset(f"Synthyra/{data_name}", split="valid") - test_fw = load_dataset(f"Synthyra/{data_name}", split="test") - tokenize_fw(valid_fw, split='valid', data_name=data_name, max_length=args.max_length, upload_repo=args.upload_repo, token=token) - tokenize_fw(test_fw, split='test', data_name=data_name, max_length=args.max_length, upload_repo=args.upload_repo, token=token) - tokenize_fw(train_fw, split='train', data_name=data_name, max_length=100000, upload_repo=args.upload_repo, token=token) # don't trim training data + main() diff --git a/evaluation/__init__.py b/evaluation/__init__.py new file mode 100644 index 000000000..0cfd2f098 --- /dev/null +++ b/evaluation/__init__.py @@ -0,0 +1 @@ +"""Repository benchmark entry points.""" diff --git a/evaluation/benchmark_esm.py b/evaluation/benchmark_esm.py index e99c71e43..95cec22e9 100644 --- a/evaluation/benchmark_esm.py +++ b/evaluation/benchmark_esm.py @@ -2,21 +2,21 @@ import argparse import os import pandas as pd +from pathlib import Path from torch.utils.data import DataLoader, Dataset as TorchDataset from datasets import Dataset from huggingface_hub import hf_hub_download, login from tqdm.auto import tqdm -from sklearn.metrics import ( - precision_score, - recall_score, - f1_score, - accuracy_score, - matthews_corrcoef -) from transformers import AutoModelForMaskedLM, AutoTokenizer from evaluation.masker import ProteinMasker -from utils import set_seed +from speedrunning_plms.evaluation import ( + download_dataset_split, + load_benchmark_manifest, + load_benchmark_model, + load_benchmark_tokenizer, +) +from speedrunning_plms.training.utils import set_seed def parse_args(): @@ -25,6 +25,12 @@ def parse_args(): parser.add_argument('--batch_size', type=int, default=4) parser.add_argument('--num_workers', type=int, default=0) parser.add_argument('--results_dir', type=str, default='results') + parser.add_argument( + '--manifest', + type=str, + default=str(Path(__file__).with_name('benchmark_manifest.json')), + help='Immutable benchmark asset manifest', + ) return parser.parse_args() @@ -59,6 +65,14 @@ def __call__(self, batch): def calculate_metrics(preds, labels): """Calculate metrics only where labels != -100""" + from sklearn.metrics import ( + accuracy_score, + f1_score, + matthews_corrcoef, + precision_score, + recall_score, + ) + # Create mask for valid positions (labels != -100) valid_mask = labels != -100 @@ -104,28 +118,18 @@ def main(): # Initialize components that don't need to be recreated for each model or dataset device = torch.device('cuda' if torch.cuda.is_available() else 'cpu') - - # Define models once - model_names = { - 'Synthyra/ESM2-8M': 'ESM2-8M', - 'Synthyra/ESM2-35M': 'ESM2-35M', - 'Synthyra/ESM2-150M': 'ESM2-150M', - 'Synthyra/ESMplusplus_small': 'ESMC-300M', - 'Synthyra/ESMplusplus_large': 'ESMC-600M', - 'Synthyra/ESM2-650M': 'ESM2-650M', - 'Synthyra/ESM2-3B': 'ESM2-3B', - } + manifest = load_benchmark_manifest(args.manifest) + tokenizer_asset = manifest['tokenizer'] all_results = [] - datasets = ['omg_prot50', 'og_prot90', 'uniref50'] - - for dataset_name in datasets: + for dataset_asset in manifest['datasets']: + dataset_name = dataset_asset['name'] for split_type in ['valid', 'test']: - local_file = hf_hub_download( - repo_id=f"Synthyra/{dataset_name}", - filename=f"data/{split_type}-00000-of-00001.parquet", - repo_type="dataset" + local_file = download_dataset_split( + dataset_asset, + split_type, + downloader=hf_hub_download, ) data = Dataset.from_parquet(local_file) print(f"Loaded {dataset_name} {split_type}: {len(data)} sequences") @@ -134,12 +138,20 @@ def main(): #sequences = sequences[-100:] # Uncomment for debugging with smaller subset print(f"Shortest sequence: {len(sequences[-1])} tokens") - for model_name, nickname in model_names.items(): + for model_asset in manifest['models']: + model_name = model_asset['repo_id'] + nickname = model_asset['nickname'] print(f"\nEvaluating {nickname} on {dataset_name} {split_type}") set_seed(42) - model = AutoModelForMaskedLM.from_pretrained(model_name, trust_remote_code=True).to(device).eval() - tokenizer = AutoTokenizer.from_pretrained('facebook/esm2_t33_650M_UR50D') + model = load_benchmark_model( + model_asset, + auto_model_cls=AutoModelForMaskedLM, + ).to(device).eval() + tokenizer = load_benchmark_tokenizer( + tokenizer_asset, + auto_tokenizer_cls=AutoTokenizer, + ) collator = ProteinCollator(tokenizer) dataset = ProteinDataset(sequences) @@ -206,7 +218,10 @@ def main(): result = { 'model': nickname, 'model_path': model_name, + 'model_revision': model_asset['revision'], 'dataset': dataset_name, + 'dataset_revision': dataset_asset['revision'], + 'tokenizer_revision': tokenizer_asset['revision'], 'split': split_type, 'loss': round(avg_loss, 3), 'perplexity': round(perplexity, 3), diff --git a/evaluation/benchmark_manifest.json b/evaluation/benchmark_manifest.json new file mode 100644 index 000000000..1d0e01ac9 --- /dev/null +++ b/evaluation/benchmark_manifest.json @@ -0,0 +1,64 @@ +{ + "schema_version": 1, + "tokenizer": { + "repo_id": "facebook/esm2_t33_650M_UR50D", + "revision": "08e4846e537177426273712802403f7ba8261b6c" + }, + "models": [ + { + "repo_id": "Synthyra/ESM2-8M", + "nickname": "ESM2-8M", + "revision": "185ecbd45665d050a8dae326d91886d330c5f9d0" + }, + { + "repo_id": "Synthyra/ESM2-35M", + "nickname": "ESM2-35M", + "revision": "37ab9f56b41e365b3bd9e25d6fefe9150fd910f0" + }, + { + "repo_id": "Synthyra/ESM2-150M", + "nickname": "ESM2-150M", + "revision": "979e0880dfc9e0c0080839b83d9d2dc05b92786a" + }, + { + "repo_id": "Synthyra/ESMplusplus_small", + "nickname": "ESMC-300M", + "revision": "46c5f7d562e47d4c14165b424c71ab7db008e6fb" + }, + { + "repo_id": "Synthyra/ESMplusplus_large", + "nickname": "ESMC-600M", + "revision": "f813401638b3fddab09748aec1ad2bf537aa4208" + }, + { + "repo_id": "Synthyra/ESM2-650M", + "nickname": "ESM2-650M", + "revision": "ca0718a5d52b80d5c60dd76860e55e061a95fb0a" + }, + { + "repo_id": "Synthyra/ESM2-3B", + "nickname": "ESM2-3B", + "revision": "ff89d0180f414ab9c677219a25da79bf09185456" + } + ], + "datasets": [ + { + "name": "omg_prot50", + "repo_id": "Synthyra/omg_prot50", + "revision": "c5b07302de5fc0e2cac87933d9167e0b2d6f05c0", + "filename": "data/{split}-00000-of-00001.parquet" + }, + { + "name": "og_prot90", + "repo_id": "Synthyra/og_prot90", + "revision": "322bcb78561007be855ccbf0b744f24bbec41c6b", + "filename": "data/{split}-00000-of-00001.parquet" + }, + { + "name": "uniref50", + "repo_id": "Synthyra/uniref50", + "revision": "36d67a647c4c596664ad2284ca9ab571baff08b9", + "filename": "data/{split}-00000-of-00001.parquet" + } + ] +} diff --git a/evaluation/masker.py b/evaluation/masker.py index 1a8293e4a..24dea5035 100644 --- a/evaluation/masker.py +++ b/evaluation/masker.py @@ -1,16 +1,13 @@ +"""Standardized protein masked-language-model corruption.""" + +from typing import Optional, Tuple + import torch import torch.nn as nn -from typing import Tuple, Optional -""" -Standardized MLM masking approach for consistency -""" class ProteinMasker(nn.Module): - def __init__(self, tokenizer, mask_rate=0.15): - """ - Implements the masking scheme from DSM with a default 15% mask probability. - """ + def __init__(self, tokenizer, mask_rate: float = 0.15): super().__init__() self.mask_token_id = tokenizer.mask_token_id self.cls_token_id = tokenizer.cls_token_id @@ -22,95 +19,40 @@ def forward( input_ids: torch.Tensor, attention_mask: Optional[torch.Tensor] = None, ) -> Tuple[torch.Tensor, torch.Tensor]: - """ - Args: - input_ids: The input token IDs. - attention_mask: Optional attention mask. - - Returns: - Tuple of (masked_input_ids, labels) - """ - eps = 1e-3 + """Return masked input IDs and labels with unmasked positions ignored.""" batch_size, seq_len = input_ids.shape device = input_ids.device if attention_mask is None: attention_mask = torch.ones_like(input_ids, device=device) - # Default to 15% masking if t not provided - t = torch.full((batch_size,), self.mask_rate, device=device) - - p_mask = t[:, None].repeat(1, seq_len) - mask_indices = torch.rand(batch_size, seq_len, device=device) < p_mask - - # Prevent cls and eos from being masked + mask_probabilities = torch.full( + (batch_size, seq_len), + self.mask_rate, + device=device, + ) + mask_indices = torch.rand(batch_size, seq_len, device=device) < mask_probabilities + cls_mask = input_ids == self.cls_token_id eos_mask = input_ids == self.eos_token_id mask_indices = mask_indices & ~cls_mask & ~eos_mask & attention_mask.bool() - - # Ensure at least one token is masked per sequence - for i in range(batch_size): - if not mask_indices[i].any() and attention_mask[i].sum() > 2: # More than just CLS/EOS - # Find valid positions (not CLS/EOS and has attention) - valid_positions = (~cls_mask[i]) & (~eos_mask[i]) & attention_mask[i].bool() + + # Avoid empty-label batches for short sequences and small batch sizes. + for row in range(batch_size): + if not mask_indices[row].any() and attention_mask[row].sum() > 2: + valid_positions = ( + ~cls_mask[row] + & ~eos_mask[row] + & attention_mask[row].bool() + ) if valid_positions.any(): - # Get indices of valid positions - valid_indices = valid_positions.nonzero(as_tuple=True)[0] - # Randomly select one position to mask - random_idx = valid_indices[torch.randint(0, valid_indices.size(0), (1,), device=device)] - mask_indices[i, random_idx] = True - - # Create masked input + candidates = valid_positions.nonzero(as_tuple=True)[0] + selected = candidates[ + torch.randint(candidates.numel(), (1,), device=device) + ] + mask_indices[row, selected] = True + masked_input_ids = torch.where(mask_indices, self.mask_token_id, input_ids) - - # Create labels for loss computation labels = input_ids.clone() - - non_mask_indices = ~mask_indices | (attention_mask == 0) - labels[non_mask_indices] = -100 - + labels[~mask_indices | (attention_mask == 0)] = -100 return masked_input_ids, labels - - -if __name__ == "__main__": - import torch - import matplotlib.pyplot as plt - from transformers import EsmTokenizer - - tokenizer = EsmTokenizer.from_pretrained("facebook/esm2_t6_8M_UR50D") - test_seqs = [ - 'MNFKYKLYSYITIFQIILILPTIVASNERCIALGGVCKDFSDCTGNYKPIDKHCDGSNNIKCCIRKIECPTSQNSNFTISGKNKEDEALPFIFKSEGGCQNDKNDNGNKINGKIGYTCAGITPMVGWKNKENYFSYAIKECTNDTNFTYCAYKLNENKFREGAKNIYIDKYAVAGKCNNLPQPAYYVCFDTSVNHGSGWSSKTITANPIGNMDGREYGLLLNKKSREKYINIVKNDSSQEKYLNGWLSRADDREKYCNNYCTSNCNCDNSASKASVSSNTNTTDIYNSVNTVDSDICNCDDNEPTDFLDDDYINNEEEIDEEIIDQEEY', - 'MYRTALYFTVCSIWLCQIITGVLSLKCKCDLCKDKNYTCITDGYCYTSATLKDGVILYNYRCLDLNFPMRNPMFCHKQIPIHHEFTLECCNDRDFCNIRLVPKLTPKDNATSDTSLGTIEIAVVIILPTLVICIIAMAIYLYYQNKRSTHHHLGLGDDSIEAPDHPILNGVSLKHMIEMTTSGSGSGLPLLVQRSIARQIQLVEIIGQGRYGEVWRGRWRGENVAVKIFSSREERSWFREAEIYQTVMLRHDNILGFIAADNKGVLSLKCKCDLCKDKNYTCITDGYCYTSATLKDGVILYNYRQLGASLNRFXVYALGLIFWEISRRCNVGGIYDEYQLPFYDAVPSDPTIEEMRRVVCVERQRPSIPNRWQSCEALHVMSKLMKECWYHNATARLTALRIKKTLANFRASEELKM' - ] - tokenized = tokenizer(test_seqs, return_tensors="pt", padding=True) - test_ids = tokenized.input_ids - attention_mask = tokenized.attention_mask - - masker = ProteinMasker(tokenizer) - - n_repeats = 1000 - mask_token_id = masker.mask_token_id - num_seqs, seq_len = test_ids.shape - - # Collect the number of masked tokens per sequence per run - masked_token_fractions = [] - - for i in range(n_repeats): - masked_ids, _ = masker.forward(test_ids.clone(), attention_mask) - # For all sequences, count number of masked tokens (excluding padding) - num_masked = ((masked_ids == mask_token_id) & (attention_mask == 1)).sum(dim=1) - num_valid = (attention_mask == 1).sum(dim=1) - frac_masked = (num_masked.float() / num_valid.float()).tolist() - masked_token_fractions.extend(frac_masked) - - # Plot histogram of all masked token fractions - import numpy as np - plt.figure(figsize=(7, 4)) - plt.hist(masked_token_fractions, bins=20, color='skyblue', edgecolor='black', alpha=0.8) - plt.axvline(0.15, color='red', linestyle='--', label='Expected mask rate (0.15)') - plt.title(f"Distribution of fraction of masked tokens per sequence (n={n_repeats*len(test_seqs)})") - plt.xlabel("Fraction of tokens masked") - plt.ylabel("Count") - plt.legend() - plt.tight_layout() - plt.show() diff --git a/example_yamls/debug.yaml b/example_yamls/debug.yaml index 7bae29306..b0aa86a4a 100644 --- a/example_yamls/debug.yaml +++ b/example_yamls/debug.yaml @@ -65,6 +65,7 @@ muon_momentum_warmup_steps: 100 # Evaluation & Logging eval_every: 100 +push_to_hub: false hf_model_name: null save_every: null diff --git a/example_yamls/default.yaml b/example_yamls/default.yaml index 888a14d1d..18d6715a7 100644 --- a/example_yamls/default.yaml +++ b/example_yamls/default.yaml @@ -65,6 +65,7 @@ muon_momentum_warmup_steps: 300 # Evaluation & Logging eval_every: 1000 +push_to_hub: false hf_model_name: "lhallee/speedrun" save_every: null # Number of steps between checkpoints diff --git a/example_yamls/patch_unet.yaml b/example_yamls/patch_unet.yaml index c24a61bde..19675631b 100644 --- a/example_yamls/patch_unet.yaml +++ b/example_yamls/patch_unet.yaml @@ -69,6 +69,7 @@ muon_momentum_warmup_steps: 300 # Evaluation & Logging eval_every: 1000 +push_to_hub: false hf_model_name: "lhallee/speedrun_patch_unet" save_every: null diff --git a/example_yamls/patch_unet_debug.yaml b/example_yamls/patch_unet_debug.yaml index 659dfa03f..46ba4bbe7 100644 --- a/example_yamls/patch_unet_debug.yaml +++ b/example_yamls/patch_unet_debug.yaml @@ -64,6 +64,7 @@ muon_momentum_warmup_steps: 10 # Evaluation & Logging eval_every: 50 +push_to_hub: false hf_model_name: "Synthyra/debug_patch_unet" save_every: null diff --git a/example_yamls/test.yaml b/example_yamls/test.yaml index 6e8f04e87..45f9e08b7 100644 --- a/example_yamls/test.yaml +++ b/example_yamls/test.yaml @@ -65,6 +65,7 @@ muon_momentum_warmup_steps: 300 # Evaluation & Logging eval_every: 1000 +push_to_hub: false hf_model_name: "lhallee/speedrun" save_every: null # Number of steps between checkpoints diff --git a/model/__init__.py b/model/__init__.py new file mode 100644 index 000000000..f937e929c --- /dev/null +++ b/model/__init__.py @@ -0,0 +1,8 @@ +import sys +from pathlib import Path + +_SRC = Path(__file__).resolve().parents[1] / "src" +if str(_SRC) not in sys.path: + sys.path.insert(0, str(_SRC)) + +from speedrunning_plms.models import * # noqa: F401,F403 diff --git a/model/attention.py b/model/attention.py index d9738dde7..80b7a5e73 100644 --- a/model/attention.py +++ b/model/attention.py @@ -1,102 +1,8 @@ -import torch -import torch.nn as nn -import torch.nn.functional as F -import math -from typing import Optional -from torch.nn.attention.flex_attention import flex_attention +import sys +from pathlib import Path -from model.utils import norm, Linear +_SRC = Path(__file__).resolve().parents[1] / "src" +if str(_SRC) not in sys.path: + sys.path.insert(0, str(_SRC)) - -class Rotary(nn.Module): - def __init__(self, dim, base=10000): - super().__init__() - self.register_buffer('inv_freq', (1 / base) ** (torch.arange(0, dim, 2) / dim)) - self.seq_len_cached = None - self.cos_cached = None - self.sin_cached = None - - def forward(self, x: torch.Tensor) -> torch.Tensor: - seq_len = x.shape[1] - if seq_len != self.seq_len_cached: - t = torch.arange(seq_len, device=x.device) - freqs = torch.outer(t, self.inv_freq) - self.seq_len_cached = seq_len - self.cos_cached = freqs.cos() - self.sin_cached = freqs.sin() - cos, sin = self.cos_cached[None, :, None, :], self.sin_cached[None, :, None, :] - # apply_rotary_emb(x, cos, sin) - x1, x2 = x.chunk(2, dim=3) - y1 = x1 * cos + x2 * sin - y2 = x1 * (-sin) + x2 * cos - return torch.cat((y1, y2), 3).type_as(x) - - -class SelfAttention(nn.Module): - def __init__(self, config): - super().__init__() - self.config = config - self.hidden_size = config.hidden_size - self.n_heads = config.num_attention_heads - self.d_head = self.hidden_size // self.n_heads - - assert self.hidden_size % self.n_heads == 0 - self.Wq = Linear(self.hidden_size, self.hidden_size) - self.Wk = Linear(self.hidden_size, self.hidden_size) - self.Wv = Linear(self.hidden_size, self.hidden_size) - self.rotary = Rotary(self.d_head) # dim // num_attention_heads = head_dim - self.Wo = Linear(self.hidden_size, self.hidden_size) - self.Wo.weight.data.zero_() # zero init suggested by @Grad6230497 - - if config.unet: - self.lambdas = nn.Parameter(torch.tensor([0.5, 0.5])) - - self.unet = config.unet - self.flex_attention = flex_attention - if config.compile_flex_attention: - self.flex_attention = torch.compile(flex_attention) - - def forward( - self, - x: torch.Tensor, - attention_mask: Optional[torch.Tensor] = None, - vi: Optional[torch.Tensor] = None, - **kwargs, - ) -> torch.Tensor: - # Support both (L, D) legacy format and (B, L, D) batched format - squeeze_out = False - if x.dim() == 2: - x = x.unsqueeze(0) # (L, D) -> (1, L, D) - squeeze_out = True - if vi is not None: - vi = vi.unsqueeze(0) - - B, l, d = x.size() - q, k, v = self.Wq(x), self.Wk(x), self.Wv(x) - - q = q.view(B, l, self.n_heads, self.d_head) - k = k.view(B, l, self.n_heads, self.d_head) - v = v.view(B, l, self.n_heads, self.d_head) - - if self.unet and vi is not None: - v = self.lambdas[0] * v + self.lambdas[1] * vi.view_as(v) - - q, k = norm(q), norm(k) - q, k = self.rotary(q), self.rotary(k) - if attention_mask is None: - assert l <= 1, "attention_mask is required for seq_len > 1 to avoid dense attention" - - y = self.flex_attention( - q.transpose(1, 2), - k.transpose(1, 2), - v.transpose(1, 2), - score_mod=None, - block_mask=attention_mask, - enable_gqa=True, - ) - y = y.transpose(1, 2).contiguous().view(B, l, d) - y = self.Wo(y) - - if squeeze_out: - y = y.squeeze(0) - return y +from speedrunning_plms.models.attention import * # noqa: F401,F403 diff --git a/model/flex_mods.py b/model/flex_mods.py index 6c2603475..74703749c 100644 --- a/model/flex_mods.py +++ b/model/flex_mods.py @@ -1,221 +1,8 @@ -# https://github.com/pytorch-labs/attention-gym/blob/main/attn_gym/mods/softcapping.py - -import math -import numpy as np -import torch -from typing import Optional +import sys from pathlib import Path -from torch.nn.attention.flex_attention import ( - _score_mod_signature, - _mask_mod_signature, - _vmap_for_bhqkv, - _ModificationType, -) - -try: - from torch._dynamo._trace_wrapped_higher_order_op import TransformGetItemToIndex -except ImportError: - from torch._higher_order_ops.flex_attention import TransformGetItemToIndex -from contextlib import nullcontext - - -def create_score_mod( - query: torch.Tensor, - key: torch.Tensor, - score_mod: Optional[_score_mod_signature], - mask_mod: Optional[_mask_mod_signature], - device: str = "cuda", - _compile: bool = False, - scale: Optional[float] = None, - batch_idx: int = 0, - head_idx: int = 0, -) -> torch.Tensor: - B = 1 - H = 1 - M = query.shape[0] - N = key.shape[0] - - b = torch.arange(0, B, device=device) + batch_idx - h = torch.arange(0, H, device=device) + head_idx - m = torch.arange(0, M, device=device) - n = torch.arange(0, N, device=device) - - scale_factor = 1 / math.sqrt(query.size(-1)) if scale is None else scale - type = _ModificationType.SCORE_MOD if score_mod is not None else _ModificationType.MASK_MOD - if _compile: - ctx = nullcontext() - else: - ctx = TransformGetItemToIndex() - - with ctx: - mod_fn = score_mod if type == _ModificationType.SCORE_MOD else mask_mod - prefix = (0,) if type == _ModificationType.SCORE_MOD else () - mod = _vmap_for_bhqkv(mod_fn, prefix=prefix) - scores = query @ key.transpose(-2, -1) - scores *= scale_factor - scores = scores.view(1, 1, M, N) - if type == _ModificationType.SCORE_MOD: - out = mod(scores, b, h, m, n) - else: - out = mod(b, h, m, n) - - return out - - -def generate_dilated_sliding_window(window_size: int, dilation: int) -> _mask_mod_signature: - """Generates a dilated sliding window attention mask. - Args: - window_size: The size of the sliding window. - dilation: The dilation factor for the sliding window. - - Note: - Query at position i can only attend to keys within a window of size `window_size` - centered around i, where the keys are at positions j such that: - * abs(i - j) <= window_size - * abs(i - j) % dilation == 0 - """ - - def dilated_sliding_window(b, h, q_idx, kv_idx): - diff = torch.abs(q_idx - kv_idx) - in_window = diff <= window_size - is_dilated = (diff % dilation) == 0 - return in_window & is_dilated - - dilated_sliding_window.__name__ = f"dilated_sliding_window_{window_size}_dilation_{dilation}" - return dilated_sliding_window - - -def _name_to_title(name: str) -> str: - title = name.replace("_", " ") - title = " ".join(word.capitalize() for word in title.split()) - return title - - -def visualize_attention_scores( - query: torch.Tensor, - key: torch.Tensor, - score_mod: Optional[_score_mod_signature] = None, - mask_mod: Optional[_mask_mod_signature] = None, - device: str = "cuda", - name: str = "attention_scores", - path: Optional[Path] = None, - batch_idx: int = 0, - head_idx: int = 0, - scale: Optional[float] = None, -): - """ - Generate and save a visualization of attention scores. - - Args: - query (Tensor): Query tensor of shape (batch_size, num_heads, seq_len_q, head_dim). - key (Tensor): Key tensor of shape (batch_size, num_heads, seq_len_k, head_dim). - score_mod (Optional[Callable]): If this is set this will take precedence over the mask_mod. - mask_mod (Optional[Callable]): The mask_mod function used to create block_mask - device (str): Device to run computations on (default: "cuda"). - name (str): Base name for the file and title (default: 'attention_scores'). - path (Path): Path to save the visualization. If None, will be saved to the current working directory. - batch_idx (int): Index of the batch to visualize (default: 0). - head_idx (int): Index of the head to visualize (default: 0). - scale (float): Scale factor to apply to the attention scores. If None, will be set to 1 / sqrt(head_dim). - - Returns: - None - """ - import matplotlib.pyplot as plt - - assert score_mod is not None or mask_mod is not None, ( - "Must provide either score_mod or mask_mod" - ) - query = query[batch_idx, head_idx, :, :] - key = key[batch_idx, head_idx, :, :] - scores_viz = create_score_mod( - query, - key, - score_mod=score_mod, - mask_mod=mask_mod, - scale=scale, - device=device, - batch_idx=batch_idx, - head_idx=head_idx, - ) - # If both score_mod and mask_mod are provided, apply both - if score_mod is not None and mask_mod is not None: - mask_viz = create_score_mod( - query, - key, - score_mod=None, - mask_mod=mask_mod, - scale=scale, - device=device, - batch_idx=batch_idx, - head_idx=head_idx, - ) - # Apply mask by setting masked positions to -inf - scores_viz = torch.where(mask_viz == 0, float("-inf"), scores_viz) - - suffix_title = f"Batch {batch_idx}, Head {head_idx}" if batch_idx != 0 or head_idx != 0 else "" - - fig, ax = plt.subplots(figsize=(12, 10)) - color = "viridis" if score_mod is not None else "cividis" - if score_mod is not None and mask_mod is not None: - color = "plasma" - im = ax.imshow(scores_viz.cpu().detach()[0, 0, :, :], aspect="auto", cmap=color) - fig.colorbar(im) - - title = _name_to_title(name) - file_path = Path(name).with_suffix(".png") if path is None else path.with_suffix(".png") - ax.set_title(f"{title}\n{suffix_title}", fontsize=20) - - ax.set_xlabel("Key Tokens", fontsize=18) - ax.set_ylabel("Query Tokens", fontsize=18) - - # Move y-axis ticks and labels to the top - ax.tick_params(axis="x", top=True, labeltop=True, bottom=False, labelbottom=False) - - # Add tick labels if the number of tokens is manageable - num_query_tokens, num_kv_tokens = scores_viz.shape[-2:] - if num_query_tokens <= 32 and num_kv_tokens <= 32: - ax.set_xticks(range(num_kv_tokens)) - rotation = 45 if num_kv_tokens > 12 else 0 - ax.set_xticklabels( - [f"KV{i}" for i in range(num_kv_tokens)], fontsize=16, rotation=rotation - ) - ax.set_yticks(range(num_query_tokens)) - ax.set_yticklabels([f"Q{i}" for i in range(num_query_tokens)], fontsize=16) - # Align grid with pixel boundaries - ax.set_xticks(np.arange(-0.5, num_kv_tokens, 1), minor=True) - ax.set_yticks(np.arange(-0.5, num_query_tokens, 1), minor=True) - ax.grid(which="minor", color="black", linestyle="-", linewidth=2) - - plt.tight_layout() - plt.savefig(file_path, dpi=300, bbox_inches="tight") - plt.close(fig) # Close the figure to free up memory - - print(f"Visualization saved as {file_path}") - - -def main(device: str = "cpu"): - """Visualize the attention scores of dilated sliding window mask mod. - - Args: - device (str): Device to use for computation. - """ - B, H, SEQ_LEN, HEAD_DIM = 1, 1, 24, 8 - - def make_tensor(): - return torch.ones(B, H, SEQ_LEN, HEAD_DIM, device=device) - - query, key = make_tensor(), make_tensor() - - dilated_sliding_window_mask = generate_dilated_sliding_window(window_size=8, dilation=4) - visualize_attention_scores( - query, - key, - mask_mod=dilated_sliding_window_mask, - device=device, - name="dilated_sliding_window_mask", - ) +_SRC = Path(__file__).resolve().parents[1] / "src" +if str(_SRC) not in sys.path: + sys.path.insert(0, str(_SRC)) -if __name__ == "__main__": - main() \ No newline at end of file +from speedrunning_plms.flex.mods import * # noqa: F401,F403 diff --git a/model/model.py b/model/model.py index 0e5ba3bf8..2ef35aff5 100644 --- a/model/model.py +++ b/model/model.py @@ -1,1102 +1,8 @@ -import math -import torch -import torch.nn as nn -import torch.nn.functional as F -from typing import Optional, List -from dataclasses import dataclass -from torch.nn.attention.flex_attention import create_block_mask -from transformers import EsmTokenizer, PretrainedConfig, PreTrainedModel -from transformers.modeling_outputs import ModelOutput +import sys +from pathlib import Path -from model.attention import SelfAttention -from model.utils import norm, MLP, Linear, BottleneckMLP +_SRC = Path(__file__).resolve().parents[1] / "src" +if str(_SRC) not in sys.path: + sys.path.insert(0, str(_SRC)) - -@dataclass -class PLMConfig(PretrainedConfig): - def __init__( - self, - hidden_size: int = 512, - num_attention_heads: int = 8, - num_hidden_layers: int = 12, - num_unet_layers: int = 0, - num_extra_layers: int = 0, - max_sequence_length: int = 1024, - vocab_size: int = 33, - expansion_ratio: float = 2.0, - soft_logit_cap: float = 16.0, - sliding_window_size: int = 2048, - tie_embeddings: bool = False, - unet: bool = False, - patch_unet: bool = False, - mlm: bool = False, - masked_diffusion: bool = False, - token_dropout: bool = True, - compile_flex_attention: bool = True, - **kwargs, - ): - super().__init__(**kwargs) - self.hidden_size = hidden_size - self.num_attention_heads = num_attention_heads - self.num_hidden_layers = num_hidden_layers - self.num_unet_layers = num_unet_layers - self.num_extra_layers = num_extra_layers - self.max_sequence_length = max_sequence_length - self.vocab_size = vocab_size - self.expansion_ratio = expansion_ratio - self.soft_logit_cap = soft_logit_cap - self.sliding_window_size = sliding_window_size - self.tie_embeddings = tie_embeddings - self.unet = unet - self.patch_unet = patch_unet - self.mlm = mlm - self.masked_diffusion = masked_diffusion - self.token_dropout = token_dropout - self.compile_flex_attention = compile_flex_attention - # HuggingFace AutoModel mapping for trust_remote_code - self.auto_map = { - "AutoModel": "model--PLM", - "AutoModelForMaskedLM": "model--PLM", - } - - -@dataclass -class ESMOutput(ModelOutput): - loss: Optional[torch.Tensor] = None - logits: Optional[torch.Tensor] = None - last_hidden_state: Optional[torch.Tensor] = None - - -def get_hidden_sizes(hidden_size: int, num_encoder_layers: int, num_attention_heads: int = 1, max_head_dim: int = 128) -> List[int]: - """Returns hidden size for each encoder layer, rounded to multiples of 64 and num_attention_heads. - Scales from hidden_size toward hidden_size * 2 at the bottleneck, capped so that - head_dim (hidden / num_heads) never exceeds max_head_dim. - - This cap prevents Triton shared memory overflow in flex_attention kernels. - For more hidden dimension growth, increase num_attention_heads (Swin Transformer style). - - Args: - hidden_size: Base hidden size - num_encoder_layers: Number of encoder layers - num_attention_heads: Number of attention heads (hidden size must be divisible by this) - max_head_dim: Maximum per-head dimension (default 128, safe for Triton SRAM) - """ - from math import gcd - # Find LCM of 64 and num_attention_heads for GPU efficiency and head divisibility - alignment = (64 * num_attention_heads) // gcd(64, num_attention_heads) - # Maximum hidden size enforced by head_dim constraint - max_hidden = num_attention_heads * max_head_dim - # Round max_hidden down to alignment - max_hidden = (max_hidden // alignment) * alignment - - sizes = [] - for i in range(num_encoder_layers): - # Linear interpolation from 1.0 to 2.0 - scale = 1.0 + (i / max(num_encoder_layers - 1, 1)) - raw_size = hidden_size * scale - # Round up to nearest alignment - rounded = int(((raw_size + alignment - 1) // alignment) * alignment) - # Clamp to max_hidden to prevent head_dim overflow - rounded = min(rounded, max_hidden) - sizes.append(rounded) - return sizes - - -class PatchMerge(nn.Module): - """Downsample sequence by 2x via Swin-style patch merging. - Concatenates adjacent token pairs and projects to new dimension. - (B, L, D_in) -> (B, L//2, D_out) - """ - def __init__(self, in_dim: int, out_dim: int): - super().__init__() - self.projection = Linear(2 * in_dim, out_dim) - - def forward(self, x: torch.Tensor) -> torch.Tensor: - B, L, D = x.shape - assert L % 2 == 0, f"Sequence length {L} must be even for PatchMerge" - x = x.view(B, L // 2, 2 * D) - return self.projection(x) - - -class PatchExpand(nn.Module): - """Upsample sequence by 2x via linear projection and reshape. - (B, L//2, D_in) -> (B, L, D_out) - """ - def __init__(self, in_dim: int, out_dim: int): - super().__init__() - self.projection = Linear(in_dim, 2 * out_dim) - self.out_dim = out_dim - - def forward(self, x: torch.Tensor) -> torch.Tensor: - B, L_half, D = x.shape - x = self.projection(x) # (B, L_half, 2 * out_dim) - return x.view(B, L_half * 2, self.out_dim) - - -class ValueEmbedding(nn.Module): - def __init__(self, config: PLMConfig): - super().__init__() - self.embed = nn.ModuleList([ - nn.Embedding(config.vocab_size, config.hidden_size) - for _ in range(config.num_hidden_layers // 2) - ]) - - def forward(self, inputs: torch.Tensor) -> List[torch.Tensor]: - ve = [emb(inputs) for emb in self.embed] - ve += reversed(ve) - return ve - - -class LMHead(nn.Module): - def __init__(self, hidden_size: int, vocab_size: int, soft_logit_cap: float = 30.0): - super().__init__() - self.dense = Linear(hidden_size, hidden_size) - self.decoder = Linear(hidden_size, vocab_size) - self.bias = nn.Parameter(torch.zeros(vocab_size)) - self.soft_logit_cap = soft_logit_cap - self.act = nn.GELU() - - def forward(self, x: torch.Tensor) -> torch.Tensor: - x = self.dense(norm(x)) - x = self.act(x) - x = self.decoder(x) + self.bias - return self.soft_logit_cap * torch.tanh(x / self.soft_logit_cap) - - -class TransformerBlock(nn.Module): - def __init__(self, config: PLMConfig): - super().__init__() - self.config = config - self.attn = SelfAttention(config) - self.mlp = MLP(config) - self.unet = config.unet - if config.unet: - self.lambdas = nn.Parameter(torch.tensor([1., 0.])) - - def forward( - self, - x: torch.Tensor, - attention_mask: Optional[torch.Tensor] = None, - vi: Optional[torch.Tensor] = None, - x0: Optional[torch.Tensor] = None, - last_eos: Optional[int] = None, - **kwargs, - ) -> torch.Tensor: - if self.unet: - x = self.lambdas[0] * x + self.lambdas[1] * x0 - x = x + self.attn( - x=norm(x), - attention_mask=attention_mask, - vi=vi, - last_eos=last_eos, - **kwargs, - ) - else: - x = x + self.attn( - x=norm(x), - attention_mask=attention_mask, - last_eos=last_eos, - **kwargs, - ) - x = x + self.mlp(norm(x)) - return x - - -class Transformer(nn.Module): - def __init__(self, config: PLMConfig): - super().__init__() - self.layers = nn.ModuleList([TransformerBlock(config) for _ in range(config.num_hidden_layers)]) - - def forward( - self, - x: torch.Tensor, - attention_mask: Optional[torch.Tensor] = None, - **kwargs, - ) -> torch.Tensor: - for layer in self.layers: - x = layer( - x=x, - attention_mask=attention_mask, - **kwargs, - ) - return x - - -class UnetTransformer(nn.Module): - def __init__(self, config: PLMConfig): - super().__init__() - assert config.num_hidden_layers % 2 == 0 - self.num_encoder_layers = config.num_hidden_layers // 2 - self.num_decoder_layers = config.num_hidden_layers // 2 - - self.skip_weights = nn.Parameter(torch.ones(self.num_decoder_layers)) - - self.layers = nn.ModuleList([TransformerBlock(config) for _ in range(config.num_hidden_layers)]) - - def forward( - self, - x: torch.Tensor, - ve: List[torch.Tensor], - attention_mask: Optional[torch.Tensor] = None, - **kwargs, - ) -> torch.Tensor: - x0 = x - ve_enc, ve_dec = ve[:self.num_encoder_layers], ve[self.num_encoder_layers:] - skip_connections = [] - for i in range(self.num_encoder_layers): - x = self.layers[i]( - x=x, - attention_mask=attention_mask, - vi=ve_enc[i], - x0=x0, - **kwargs, - ) - skip_connections.append(x) - - for i in range(self.num_decoder_layers): - x = x + self.skip_weights[i] * skip_connections.pop() - x = self.layers[self.num_encoder_layers + i]( - x=x, - attention_mask=attention_mask, - vi=ve_dec[i], - x0=x0, - **kwargs, - ) - return x - - -class BatchedTransformerBlock(nn.Module): - """TransformerBlock for batched (B, L, D) input with variable hidden sizes per layer. - Supports x0 lambda mixing and value embedding mixing in attention. - """ - def __init__( - self, - hidden_size: int, - num_attention_heads: int, - expansion_ratio: float, - base_hidden_size: int = None, - compile_flex_attention: bool = True, - ): - super().__init__() - from types import SimpleNamespace - config = SimpleNamespace( - hidden_size=hidden_size, - num_attention_heads=num_attention_heads, - unet=True, - compile_flex_attention=compile_flex_attention, - ) - self.attn = SelfAttention(config) - - from model.utils import correction_fn - corrected_dim = correction_fn(expansion_ratio, hidden_size) - self.mlp_up = Linear(hidden_size, corrected_dim) - self.mlp_down = Linear(corrected_dim, hidden_size) - self.mlp_down.weight.data.zero_() - self.mlp_relu = nn.ReLU() - - self.lambdas = nn.Parameter(torch.tensor([1., 0.])) - - if base_hidden_size is not None and base_hidden_size != hidden_size: - self.x0_projection = Linear(base_hidden_size, hidden_size) - else: - self.x0_projection = None - - def forward( - self, - x: torch.Tensor, - attention_mask: Optional[torch.Tensor] = None, - vi: Optional[torch.Tensor] = None, - x0: Optional[torch.Tensor] = None, - **kwargs, - ) -> torch.Tensor: - if x0 is not None: - if self.x0_projection is not None: - x0 = self.x0_projection(x0) - x = self.lambdas[0] * x + self.lambdas[1] * x0 - - x = x + self.attn(x=norm(x), attention_mask=attention_mask, vi=vi, **kwargs) - mlp_out = self.mlp_down(self.mlp_relu(self.mlp_up(norm(x))).square()) - x = x + mlp_out - return x - - -class BatchedValueEmbedding(nn.Module): - """Value embeddings for batched UNet with variable hidden sizes per layer. - Embeddings are computed at full resolution from input_ids (B, L). - Spatial downsampling to match each layer's resolution is handled by the transformer. - """ - def __init__(self, vocab_size: int, hidden_sizes: List[int]): - super().__init__() - num_encoder_layers = len(hidden_sizes) - self.encoder_embed = nn.ModuleList([ - nn.Embedding(vocab_size, hidden_sizes[i]) - for i in range(num_encoder_layers) - ]) - self.decoder_embed = nn.ModuleList([ - nn.Embedding(vocab_size, hidden_sizes[num_encoder_layers - 1 - i]) - for i in range(num_encoder_layers) - ]) - - def forward(self, input_ids: torch.Tensor) -> tuple: - """ - input_ids: (B, L) - Returns (encoder_ve, decoder_ve) lists of value embeddings at full resolution. - encoder_ve[i] has shape (B, L, hidden_sizes[i]). - """ - encoder_ve = [emb(input_ids) for emb in self.encoder_embed] - decoder_ve = [emb(input_ids) for emb in self.decoder_embed] - return encoder_ve, decoder_ve - - -@torch.compiler.disable -def precompute_multiresolution_masks( - input_ids: torch.Tensor, - cls_token_id: int, - pad_token_id: int, - num_levels: int, - sliding_window_size: int, - n_heads: int, - device: torch.device, -) -> List[Optional[object]]: - """Pre-compute flex attention block masks at each UNet resolution level. - - This function is excluded from torch.compile via @torch.compiler.disable because - create_block_mask is designed to run outside compiled regions, and tensors captured - by mask_mod closures must be real (eager) tensors -- not Inductor ComputedBuffers - with FlexibleLayout, which cause LoweringException in flex_attention_backward. - - Args: - input_ids: (B, L) token IDs - cls_token_id: CLS/BOS token ID marking document starts - pad_token_id: PAD token ID - num_levels: Number of resolution levels (including full resolution) - sliding_window_size: Sliding window size for attention - n_heads: Number of attention heads - device: Device for mask computation - - Returns: - List of BlockMask objects, one per resolution level. None for levels where L<=1. - """ - B, L = input_ids.shape - - # Compute document IDs from CLS token positions (CLS marks start of each document) - doc_ids = (input_ids == cls_token_id).cumsum(dim=1) # (B, L) - - # Find last real (non-pad) token position per batch element - is_real = (input_ids != pad_token_id) - positions = torch.arange(L, device=device).expand(B, L) - last_real = torch.where(is_real, positions, torch.zeros_like(positions)).max(dim=1).values # (B,) - - masks = [] - current_doc_ids = doc_ids - current_last_real = last_real - current_L = L - - for level in range(num_levels): - if current_L <= 1: - masks.append(None) - continue - - # Capture loop variables in closure via default args - def make_mask_mod(doc_ids_l, last_real_l, sw_l): - def mask_mod(b, h, q_idx, kv_idx): - doc_mask = doc_ids_l[b, q_idx] == doc_ids_l[b, kv_idx] - sw_mask = torch.abs(q_idx - kv_idx) < sw_l - pad_mask = (q_idx <= last_real_l[b]) & (kv_idx <= last_real_l[b]) - return doc_mask & sw_mask & pad_mask - return mask_mod - - mask_mod = make_mask_mod(current_doc_ids, current_last_real, sliding_window_size) - - block_mask = create_block_mask( - mask_mod=mask_mod, - B=B, - H=n_heads, - Q_LEN=current_L, - KV_LEN=current_L, - device=device, - ) - masks.append(block_mask) - - # Downsample doc_ids and last_real for next level - if current_L > 1: - current_doc_ids = current_doc_ids.view(B, current_L // 2, 2).max(dim=-1).values - current_last_real = current_last_real // 2 - current_L = current_L // 2 - - return masks - - -class BatchedUnetTransformer(nn.Module): - """Batched UNet Transformer with Swin-style patch merging/expanding. - - Operates on (B, L, D) tensors with pre-computed multi-resolution block masks. - Uses PatchMerge for downsampling and PatchExpand for upsampling. - Skip connections link encoder and decoder at matching resolutions. - - Architecture: - - Encoder: TransformerBlock -> PatchMerge -> TransformerBlock -> PatchMerge -> ... - - BottleneckMLP at vector depth (when L=1) - - Decoder: PatchExpand -> TransformerBlock + skip -> PatchExpand -> ... - """ - def __init__(self, config: PLMConfig): - super().__init__() - assert config.num_unet_layers % 2 == 0, "num_unet_layers must be even" - assert config.max_sequence_length > 0 and (config.max_sequence_length & (config.max_sequence_length - 1)) == 0, \ - f"max_sequence_length must be a power of 2 for PatchMerge, got {config.max_sequence_length}" - - self.num_encoder_layers = config.num_unet_layers // 2 - self.num_decoder_layers = config.num_unet_layers // 2 - self.base_hidden_size = config.hidden_size - self.max_sequence_length = config.max_sequence_length - - # Vector depth: after this many downsamplings, seq_len=1 - self.vector_depth = int(math.log2(config.max_sequence_length)) - - # Hidden sizes for each encoder layer depth - self.hidden_sizes = get_hidden_sizes(config.hidden_size, self.num_encoder_layers, config.num_attention_heads) - - # Number of resolution levels (for mask pre-computation) - self.num_resolution_levels = min(self.num_encoder_layers, self.vector_depth + 1) - - # Encoder blocks - self.encoder_blocks = nn.ModuleList() - self.downsamples = nn.ModuleList() - - for i in range(self.num_encoder_layers): - layer_hidden_size = self.hidden_sizes[min(i, self.vector_depth)] - - if i >= self.vector_depth: - self.encoder_blocks.append( - BottleneckMLP(layer_hidden_size, config.expansion_ratio, self.base_hidden_size) - ) - else: - self.encoder_blocks.append( - BatchedTransformerBlock( - hidden_size=layer_hidden_size, - num_attention_heads=config.num_attention_heads, - expansion_ratio=config.expansion_ratio, - base_hidden_size=self.base_hidden_size, - compile_flex_attention=config.compile_flex_attention, - ) - ) - - # PatchMerge between layers (not after last encoder, not past vector depth) - if i < self.num_encoder_layers - 1 and i < self.vector_depth: - next_hidden = self.hidden_sizes[min(i + 1, self.vector_depth)] - self.downsamples.append(PatchMerge(layer_hidden_size, next_hidden)) - - # Decoder blocks - self.decoder_blocks = nn.ModuleList() - self.upsamples = nn.ModuleList() - - for i in range(self.num_decoder_layers): - enc_idx = self.num_encoder_layers - 1 - i - effective_depth = enc_idx - decoder_hidden_size = self.hidden_sizes[min(enc_idx, self.vector_depth)] - - # PatchExpand before each decoder layer (except first/bottleneck) - prev_depth = self.num_encoder_layers - i - if i > 0 and prev_depth <= self.vector_depth: - prev_hidden = self.hidden_sizes[min(prev_depth, self.vector_depth)] - self.upsamples.append(PatchExpand(prev_hidden, decoder_hidden_size)) - - if effective_depth >= self.vector_depth: - self.decoder_blocks.append( - BottleneckMLP(decoder_hidden_size, config.expansion_ratio, self.base_hidden_size) - ) - else: - self.decoder_blocks.append( - BatchedTransformerBlock( - hidden_size=decoder_hidden_size, - num_attention_heads=config.num_attention_heads, - expansion_ratio=config.expansion_ratio, - base_hidden_size=self.base_hidden_size, - compile_flex_attention=config.compile_flex_attention, - ) - ) - - # Skip connection weights - self.skip_weights = nn.Parameter(torch.ones(self.num_decoder_layers)) - - # Input/output projections if base hidden size differs from first layer - if self.hidden_sizes[0] != config.hidden_size: - self.input_projection = Linear(config.hidden_size, self.hidden_sizes[0]) - self.output_projection = Linear(self.hidden_sizes[0], config.hidden_size) - else: - self.input_projection = None - self.output_projection = None - - def _downsample_to_resolution(self, x: torch.Tensor, target_L: int) -> torch.Tensor: - """Average-pool pairs to spatially downsample x to target sequence length.""" - B, L, D = x.shape - while L > target_L: - assert L % 2 == 0, f"Cannot halve sequence length {L}" - x = x.view(B, L // 2, 2, D).mean(dim=2) - L = L // 2 - return x - - def forward( - self, - x: torch.Tensor, - encoder_ve: List[torch.Tensor], - decoder_ve: List[torch.Tensor], - attention_masks: List[Optional[object]], - x0_full: torch.Tensor, - **kwargs, - ) -> torch.Tensor: - """ - Forward pass for batched UNet. - - Args: - x: (B, L, D) input embeddings - encoder_ve: List of value embeddings at full resolution per encoder layer - decoder_ve: List of value embeddings at full resolution per decoder layer - attention_masks: Pre-computed BlockMask per resolution level - x0_full: (B, L, D_base) original input for lambda mixing - """ - # Project input to first layer hidden size if needed - if self.input_projection is not None: - x = self.input_projection(x) - - # Encoder path - skip_connections = [] - mask_idx = 0 - downsample_idx = 0 - current_L = x.shape[1] - - for i in range(self.num_encoder_layers): - # Attention mask for this resolution - attn_mask = attention_masks[mask_idx] if mask_idx < len(attention_masks) else None - - # Downsample value embedding to current resolution - vi = None - if i < len(encoder_ve): - vi = self._downsample_to_resolution(encoder_ve[i], current_L) - - # Downsample x0 to current resolution (x0 stays at base_hidden_size, - # each block's x0_projection handles dim change) - x0_current = self._downsample_to_resolution(x0_full, current_L) - - # Apply block - x = self.encoder_blocks[i]( - x=x, - attention_mask=attn_mask, - vi=vi, - x0=x0_current, - **kwargs, - ) - skip_connections.append(x) - - # Downsample for next layer - if i < self.num_encoder_layers - 1 and i < self.vector_depth: - x = self.downsamples[downsample_idx](x) - downsample_idx += 1 - mask_idx += 1 - current_L = x.shape[1] - - # Decoder path - upsample_idx = 0 - for i in range(self.num_decoder_layers): - skip = skip_connections.pop() - - effective_depth = self.num_encoder_layers - 1 - i - prev_depth = self.num_encoder_layers - i - - # Upsample x to match skip resolution - if i > 0 and prev_depth <= self.vector_depth: - x = self.upsamples[upsample_idx](x) - upsample_idx += 1 - current_L = x.shape[1] - - # Add skip connection - x = x + self.skip_weights[i] * skip - - # Attention mask for decoder at this resolution - dec_mask_idx = min(effective_depth, len(attention_masks) - 1) - attn_mask = attention_masks[dec_mask_idx] if attention_masks else None - - # Downsample value embedding to current resolution - vi = None - if i < len(decoder_ve): - vi = self._downsample_to_resolution(decoder_ve[i], current_L) - - # Downsample x0 to current resolution - x0_current = self._downsample_to_resolution(x0_full, current_L) - - # Apply block - x = self.decoder_blocks[i]( - x=x, - attention_mask=attn_mask, - vi=vi, - x0=x0_current, - **kwargs, - ) - - # Project output back to base hidden size if needed - if self.output_projection is not None: - x = self.output_projection(x) - - return x - - -class PLM(PreTrainedModel): - config_class = PLMConfig - def __init__(self, config: PLMConfig): - super().__init__(config) - self.config = config - self.tokenizer = EsmTokenizer.from_pretrained('facebook/esm2_t6_8M_UR50D') - self.cls_token_id = self.tokenizer.cls_token_id - self.eos_token_id = self.tokenizer.eos_token_id - self.pad_token_id = self.tokenizer.pad_token_id - self.mask_token_id = self.tokenizer.mask_token_id - self.mlm = config.mlm - self.masked_diffusion = config.masked_diffusion - self.token_dropout = config.token_dropout - - self.vocab_size = config.vocab_size - self.n_heads = config.num_attention_heads - self.sliding_window_size = config.sliding_window_size - - self.embedding = nn.Embedding(config.vocab_size, config.hidden_size) - - self.unet = config.unet - self.patch_unet = config.patch_unet - - if config.patch_unet: - # Batched UNet with Swin-style patch merge/expand - assert config.num_unet_layers > 0, "num_unet_layers must be > 0 for patch_unet" - self.transformer = BatchedUnetTransformer(config) - hidden_sizes = self.transformer.hidden_sizes - self.value_embeds = BatchedValueEmbedding(config.vocab_size, hidden_sizes) - elif config.unet: - # Original UNet (skip connections only, no downsampling) - self.transformer = UnetTransformer(config) - self.value_embeds = ValueEmbedding(config) - else: - # Standard transformer - self.transformer = Transformer(config) - - # Extra sequential transformer layers after U-Net (at full resolution) - self.num_extra_layers = config.num_extra_layers - if config.num_extra_layers > 0: - # Create a config for extra layers without unet skip connections - from copy import copy - extra_config = copy(config) - extra_config.unet = False - self.extra_layers = nn.ModuleList([ - TransformerBlock(extra_config) - for _ in range(config.num_extra_layers) - ]) - else: - self.extra_layers = None - - self.lm_head = LMHead(config.hidden_size, config.vocab_size, config.soft_logit_cap) - if config.tie_embeddings: - self.lm_head.decoder.weight = self.embedding.weight - - self.ce = nn.CrossEntropyLoss(ignore_index=-100, reduction='mean') - - def get_last_hidden_state(self, input_ids: torch.Tensor, sliding_window_size: int) -> torch.Tensor: - if self.patch_unet: - # Batched UNet path: input_ids is (B, L) - assert input_ids.dim() == 2, f"patch_unet expects (B, L) input, got shape {input_ids.shape}" - B, L = input_ids.shape - - # Pre-compute multi-resolution block masks - attention_masks = precompute_multiresolution_masks( - input_ids=input_ids, - cls_token_id=self.cls_token_id, - pad_token_id=self.pad_token_id, - num_levels=self.transformer.num_resolution_levels, - sliding_window_size=sliding_window_size, - n_heads=self.n_heads, - device=input_ids.device, - ) - - # Full resolution mask for extra layers - full_res_mask = attention_masks[0] - - x = self.embedding(input_ids) # (B, L, D) - - if self.token_dropout: - x = x.masked_fill((input_ids == self.mask_token_id).unsqueeze(-1), 0.0) - real_token_count = (input_ids != self.pad_token_id).sum(dim=1, keepdim=True).float().clamp(min=1) - mask_count = (input_ids == self.mask_token_id).sum(dim=1, keepdim=True).float() - mask_ratio_observed = mask_count / real_token_count - x = (x * (1 - mask_ratio_observed.unsqueeze(-1))).to(x.dtype) - - x = norm(x) - - encoder_ve, decoder_ve = self.value_embeds(input_ids) - - x = self.transformer( - x=x, - encoder_ve=encoder_ve, - decoder_ve=decoder_ve, - attention_masks=attention_masks, - x0_full=x.clone(), - ) - - # Apply extra layers at full resolution - if self.extra_layers is not None: - for layer in self.extra_layers: - x = layer(x=x, attention_mask=full_res_mask) - - return x - - # Standard / UNet path: input_ids is 1D (total_len,) - docs = (input_ids == self.cls_token_id).cumsum(0) - eos_positions = (input_ids == self.eos_token_id).nonzero() - if eos_positions.numel() > 0: - last_eos = eos_positions[-1].squeeze() - else: - last_eos = len(input_ids) - 1 - seq_len = len(input_ids) - - def doc_mask_mod(b, h, q_idx, kv_idx): - bidirectional_sliding_window_mask = torch.abs(q_idx - kv_idx) < sliding_window_size - doc_mask = docs[q_idx] == docs[kv_idx] - pad_mask = (q_idx <= last_eos) & (kv_idx <= last_eos) - return bidirectional_sliding_window_mask & doc_mask & pad_mask - - attention_mask = create_block_mask( - mask_mod=doc_mask_mod, - B=1, - H=self.n_heads, - Q_LEN=seq_len, - KV_LEN=seq_len, - device=input_ids.device, - ) - - x = self.embedding(input_ids) - - if self.token_dropout: - x = x.masked_fill((input_ids == self.mask_token_id).unsqueeze(-1), 0.0) - real_token_count = len(input_ids[:last_eos]) - mask_ratio_observed = (input_ids == self.mask_token_id).sum().float() / real_token_count - x = (x * (1 - mask_ratio_observed)).to(x.dtype) - - x = norm(x) - - if self.unet: - ve = self.value_embeds(input_ids) - x = self.transformer(x=x, ve=ve, attention_mask=attention_mask, last_eos=last_eos) - else: - x = self.transformer(x=x, attention_mask=attention_mask, last_eos=last_eos) - - if self.extra_layers is not None: - for layer in self.extra_layers: - x = layer(x=x, attention_mask=attention_mask, last_eos=last_eos) - - return x - - def get_vector_embeddings(self, input_ids: torch.Tensor, sliding_window_size: Optional[int] = None) -> torch.Tensor: - """Mean-pool hidden states per document to get per-document embeddings. - - Args: - input_ids: (B, L) for patch_unet or (total_len,) for standard/unet - sliding_window_size: Override sliding window size - - Returns: - For patch_unet (B, L): flattened (total_docs, hidden_size) across all batch elements - For standard (total_len,): (num_docs, hidden_size) - """ - if sliding_window_size is None: - sliding_window_size = self.sliding_window_size - x = self.get_last_hidden_state(input_ids, sliding_window_size) - - if self.patch_unet: - # Batched: x is (B, L, D), input_ids is (B, L) - B, L, D = x.shape - doc_ids = (input_ids == self.cls_token_id).cumsum(dim=1) # (B, L) - # Flatten batch into single sequence for mean pooling - x_flat = x.reshape(-1, D) # (B*L, D) - # Offset doc_ids per batch element so each batch has unique doc IDs - max_docs_per_batch = doc_ids.max(dim=1).values # (B,) - offsets = torch.zeros(B, dtype=doc_ids.dtype, device=doc_ids.device) - offsets[1:] = max_docs_per_batch[:-1].cumsum(0) - doc_ids = doc_ids + offsets.unsqueeze(1) - doc_ids_flat = doc_ids.reshape(-1) # (B*L,) - # Exclude padding positions - pad_mask = (input_ids.reshape(-1) != self.pad_token_id) - num_docs = doc_ids_flat.max().item() - doc_ids_0based = doc_ids_flat - 1 - doc_embeds = [] - for doc_idx in range(num_docs): - mask = (doc_ids_0based == doc_idx) & pad_mask - if mask.any(): - doc_embeds.append(x_flat[mask].mean(dim=0)) - return torch.stack(doc_embeds, dim=0) - else: - # Legacy 1D path - docs = (input_ids == self.cls_token_id).cumsum(0) - x = x.view(-1, self.config.hidden_size) - num_docs = docs.max().item() - doc_ids = docs - 1 - doc_embeds = [] - for doc_idx in range(num_docs): - mask = (doc_ids == doc_idx) - doc_embeds.append(x[mask].mean(dim=0)) - return torch.stack(doc_embeds, dim=0) - - def forward( - self, - input_ids: torch.Tensor, - labels: torch.Tensor, - mask_rate: torch.Tensor, - sliding_window_size: Optional[int] = None, - return_logits: bool = False, - ) -> torch.Tensor: - if sliding_window_size is None: - sliding_window_size = self.sliding_window_size - - last_hidden_state = self.get_last_hidden_state(input_ids, sliding_window_size) - - lm_logits = self.lm_head(norm(last_hidden_state)) # (l, v) - - loss = self.ce( - lm_logits.view(-1, self.vocab_size), - labels.view(-1).long() - ) - if self.training and self.masked_diffusion and not self.mlm: - loss = loss / mask_rate - - if return_logits: - return loss, lm_logits - return loss - - @torch.no_grad() - def get_logits(self, input_ids: torch.Tensor, sliding_window_size: Optional[int] = None) -> torch.Tensor: - """Get LM logits without computing loss. - - Args: - input_ids: (B, L) for patch_unet or (total_len,) for standard/unet - sliding_window_size: Override sliding window size - - Returns: - Logits tensor with shape matching input + vocab dim - """ - if sliding_window_size is None: - sliding_window_size = self.sliding_window_size - hidden = self.get_last_hidden_state(input_ids, sliding_window_size) - return self.lm_head(norm(hidden)) - - @torch.no_grad() - def get_embeddings( - self, - input_ids: torch.Tensor, - sliding_window_size: Optional[int] = None, - pooling: str = 'mean', - ) -> torch.Tensor: - """Get per-sequence pooled embeddings. - - Args: - input_ids: (B, L) for patch_unet or (total_len,) for standard/unet - sliding_window_size: Override sliding window size - pooling: 'mean' for mean pooling over non-pad tokens, 'cls' for CLS token embedding - - Returns: - (num_sequences, hidden_size) embeddings - """ - if sliding_window_size is None: - sliding_window_size = self.sliding_window_size - hidden = self.get_last_hidden_state(input_ids, sliding_window_size) - - if self.patch_unet: - # Batched: hidden is (B, L, D), input_ids is (B, L) - assert input_ids.dim() == 2 - B, L, D = hidden.shape - if pooling == 'cls': - # CLS is the first token of each chunk - return hidden[:, 0, :] # (B, D) - else: - # Mean pool over non-pad tokens per batch element - mask = (input_ids != self.pad_token_id).unsqueeze(-1).float() # (B, L, 1) - return (hidden * mask).sum(dim=1) / mask.sum(dim=1).clamp(min=1) # (B, D) - else: - # Legacy 1D: hidden is (total_len, D) - if pooling == 'cls': - # Return embedding at each CLS position - cls_mask = (input_ids == self.cls_token_id) - return hidden[cls_mask] # (num_docs, D) - else: - # Mean pool per document - return self.get_vector_embeddings(input_ids, sliding_window_size) - - def push_code_and_config_to_hub(self, repo_id: str): - """Push source code and model config to HuggingFace Hub (no weights). - - Call once at the start of training so the repo is ready for - trust_remote_code=True loading as soon as weights are uploaded later. - """ - import shutil - import tempfile - from pathlib import Path - from huggingface_hub import HfApi - - with tempfile.TemporaryDirectory() as tmpdir: - # Save only the config (this also writes config.json) - self.config.save_pretrained(tmpdir) - - # Copy source files needed for trust_remote_code - model_dir = Path(__file__).parent - for src_file in ['model.py', 'attention.py', 'utils.py']: - src_path = model_dir / src_file - if src_path.exists(): - shutil.copy2(src_path, Path(tmpdir) / src_file) - - api = HfApi() - api.create_repo(repo_id=repo_id, repo_type="model", exist_ok=True) - api.upload_folder( - folder_path=tmpdir, - repo_id=repo_id, - repo_type="model", - ) - - def save_weights_local(self, save_dir: str, step: int): - """Save model weights and optimizer-resumable checkpoint locally.""" - from pathlib import Path - save_path = Path(save_dir) - save_path.mkdir(parents=True, exist_ok=True) - self.save_pretrained(save_path / f"step_{step:06d}") - - def push_weights_to_hub(self, repo_id: str): - """Push model weights to HuggingFace Hub (code + config already there).""" - import tempfile - from huggingface_hub import HfApi - - with tempfile.TemporaryDirectory() as tmpdir: - self.save_pretrained(tmpdir) - - api = HfApi() - api.create_repo(repo_id=repo_id, repo_type="model", exist_ok=True) - api.upload_folder( - folder_path=tmpdir, - repo_id=repo_id, - repo_type="model", - ) - - -if __name__ == "__main__": - # py -m model.model - import sys - import io - sys.stdout = io.TextIOWrapper(sys.stdout.buffer, encoding='utf-8') - - from torchinfo import summary - - print("=" * 80) - print("Testing Original UNet Transformer") - print("=" * 80) - config = PLMConfig( - hidden_size=768, - num_attention_heads=6, - num_hidden_layers=24, - expansion_ratio=8/3, - unet=True, - max_sequence_length=1024, - ) - model = PLM(config).cuda() - print(f"Model parameters: {sum(p.numel() for p in model.parameters()):,}") - - # Create test input with proper structure (CLS + sequence + EOS) - 1D for legacy path - seq_len = 128 - input_ids = torch.randint(4, 33, (seq_len,)).cuda() - input_ids[0] = 0 # CLS token - input_ids[-1] = 2 # EOS token - labels = input_ids.clone() - labels[labels != 32] = -100 - mask_rate = torch.tensor(0.15).cuda() - - loss = model(input_ids, labels, mask_rate) - print(f"Original UNet loss: {loss.item():.4f}") - - print("\n" + "=" * 80) - print("Testing Batched UNet Transformer (patch_unet)") - print("=" * 80) - max_length = 128 # Power of 2 for patch merging - patch_config = PLMConfig( - hidden_size=384, - num_attention_heads=6, - num_unet_layers=8, # 4 encoder + 4 decoder - num_extra_layers=2, - max_sequence_length=max_length, - expansion_ratio=8/3, - patch_unet=True, - ) - patch_model = PLM(patch_config).cuda() - print(f"Model parameters: {sum(p.numel() for p in patch_model.parameters()):,}") - - # Create batched test input (B, max_length) with packed documents per element - B = 4 - batched_ids = torch.randint(4, 33, (B, max_length)).cuda() - for b in range(B): - # Insert CLS at start and EOS at end of each chunk - batched_ids[b, 0] = 0 - batched_ids[b, max_length - 1] = 2 - # Add a second document boundary in the middle - mid = max_length // 2 - batched_ids[b, mid - 1] = 2 # EOS for doc 1 - batched_ids[b, mid] = 0 # CLS for doc 2 - batched_labels = batched_ids.clone() - batched_labels[batched_labels != 32] = -100 - - loss = patch_model(batched_ids, batched_labels, mask_rate) - print(f"Batched UNet loss: {loss.item():.4f}") - - print(f"\nHidden sizes: {patch_model.transformer.hidden_sizes}") - print(f"Vector depth (log2(max_length)): {patch_model.transformer.vector_depth}") - print(f"Num encoder layers: {patch_model.transformer.num_encoder_layers}") - print(f"Num decoder layers: {patch_model.transformer.num_decoder_layers}") - - print("\n" + "=" * 80) - print("Testing Batched UNet with deep layers (MLP at vector depth)") - print("=" * 80) - deep_config = PLMConfig( - hidden_size=384, - num_attention_heads=6, - num_unet_layers=20, # 10 encoder + 10 decoder (some will be MLPs) - num_extra_layers=1, - max_sequence_length=128, # log2(128)=7, so layers 7+ become MLPs - expansion_ratio=8/3, - patch_unet=True, - ) - deep_model = PLM(deep_config).cuda() - - # Count transformer vs MLP blocks - n_transformer = sum(1 for b in deep_model.transformer.encoder_blocks if isinstance(b, BatchedTransformerBlock)) - n_mlp = sum(1 for b in deep_model.transformer.encoder_blocks if isinstance(b, BottleneckMLP)) - print(f"Encoder: {n_transformer} transformer blocks, {n_mlp} MLP blocks") - - n_transformer_dec = sum(1 for b in deep_model.transformer.decoder_blocks if isinstance(b, BatchedTransformerBlock)) - n_mlp_dec = sum(1 for b in deep_model.transformer.decoder_blocks if isinstance(b, BottleneckMLP)) - print(f"Decoder: {n_transformer_dec} transformer blocks, {n_mlp_dec} MLP blocks") - - loss = deep_model(batched_ids, batched_labels, mask_rate) - print(f"Deep Batched UNet loss: {loss.item():.4f}") - - print("\n" + "=" * 80) - print("Testing Multi-Resolution Mask Pre-computation") - print("=" * 80) - - # Verify mask shapes at each resolution level - from model.model import precompute_multiresolution_masks - masks = precompute_multiresolution_masks( - input_ids=batched_ids, - cls_token_id=0, - pad_token_id=1, - num_levels=patch_model.transformer.num_resolution_levels, - sliding_window_size=128, - n_heads=6, - device=batched_ids.device, - ) - for i, m in enumerate(masks): - if m is not None: - print(f"Level {i}: mask shape Q_LEN={m.shape[-2]}, KV_LEN={m.shape[-1]}") - else: - print(f"Level {i}: None (vector depth)") - - print("\n" + "=" * 80) - print("All tests passed!") - print("=" * 80) \ No newline at end of file +from speedrunning_plms.models.plm import * # noqa: F401,F403 diff --git a/model/utils.py b/model/utils.py index 70e9b73ba..60144a236 100644 --- a/model/utils.py +++ b/model/utils.py @@ -1,68 +1,8 @@ -import torch -import torch.nn as nn -import torch.nn.functional as F +import sys +from pathlib import Path +_SRC = Path(__file__).resolve().parents[1] / "src" +if str(_SRC) not in sys.path: + sys.path.insert(0, str(_SRC)) -def norm(x: torch.Tensor) -> torch.Tensor: - return F.rms_norm(x, (x.size(-1),)) - - -class Linear(nn.Linear): - def __init__(self, in_features, out_features): - super().__init__(in_features, out_features, bias=False) - - def forward(self, x: torch.Tensor) -> torch.Tensor: - return F.linear(x, self.weight.to(x.dtype)) - - -def correction_fn(expansion_ratio: float, d_model: int) -> int: - return int(((expansion_ratio * d_model) + 255) // 256 * 256) - - -class MLP(nn.Module): - def __init__(self, config): - super().__init__() - corrected_dim = correction_fn(config.expansion_ratio, config.hidden_size) - self.up = Linear(config.hidden_size, corrected_dim) - self.down = Linear(corrected_dim, config.hidden_size) - self.down.weight.data.zero_() - self.relu = nn.ReLU() - - def forward(self, x: torch.Tensor) -> torch.Tensor: - return self.down(self.relu(self.up(x)).square()) - - -class BottleneckMLP(nn.Module): - """MLP block used when sequence is a vector (length 1) in Conv1D UNet. - Replaces transformer blocks at depths where sequence length = 1. - Takes hidden_size directly instead of config to support variable sizes per layer. - """ - def __init__(self, hidden_size: int, expansion_ratio: float, base_hidden_size: int = None): - super().__init__() - corrected_dim = correction_fn(expansion_ratio, hidden_size) - self.up = Linear(hidden_size, corrected_dim) - self.down = Linear(corrected_dim, hidden_size) - self.down.weight.data.zero_() - self.relu = nn.ReLU() - self.lambdas = nn.Parameter(torch.tensor([1., 0.])) - - # Projection layer for x0 if hidden sizes differ (for Conv1D UNet) - if base_hidden_size is not None and base_hidden_size != hidden_size: - self.x0_projection = Linear(base_hidden_size, hidden_size) - else: - self.x0_projection = None - - def forward( - self, - x: torch.Tensor, - x0: torch.Tensor = None, - **kwargs, - ) -> torch.Tensor: - # Apply residual mixing with x0 if provided (for UNet skip connections) - if x0 is not None: - if self.x0_projection is not None: - x0 = self.x0_projection(x0) - x = self.lambdas[0] * x + self.lambdas[1] * x0 - # Two-layer MLP with squared ReLU - out = self.down(self.relu(self.up(norm(x))).square()) - return x + out +from speedrunning_plms.models.layers import * # noqa: F401,F403 diff --git a/optimizer.py b/optimizer.py index a310eb247..974056859 100644 --- a/optimizer.py +++ b/optimizer.py @@ -1,120 +1,8 @@ -import os -import torch -import torch.distributed as dist +import sys +from pathlib import Path +_SRC = Path(__file__).resolve().parent / "src" +if str(_SRC) not in sys.path: + sys.path.insert(0, str(_SRC)) -### Muon optimizer -@torch.compile -def zeropower_via_newtonschulz5(G, steps): - """ - Newton-Schulz iteration to compute the zeroth power / orthogonalization of G. We opt to use a - quintic iteration whose coefficients are selected to maximize the slope at zero. For the purpose - of minimizing steps, it turns out to be empirically effective to keep increasing the slope at - zero even beyond the point where the iteration no longer converges all the way to one everywhere - on the interval. This iteration therefore does not produce UV^T but rather something like US'V^T - where S' is diagonal with S_{ii}' ~ Uniform(0.5, 1.5), which turns out not to hurt model - performance at all relative to UV^T, where USV^T = G is the SVD. - """ - assert len(G.shape) == 2 - a, b, c = (3.4445, -4.7750, 2.0315) - X = G.bfloat16() - if G.size(0) > G.size(1): - X = X.T - - # Ensure spectral norm is at most 1 - X = X / (X.norm() + 1e-7) - # Perform the NS iterations - for _ in range(steps): - A = X @ X.T - B = b * A + c * A @ A # adapted from suggestion by @jxbz, @leloykun, and @YouJiacheng - X = a * X + B @ X - - if G.size(0) > G.size(1): - X = X.T - return X - - -class Muon(torch.optim.Optimizer): - """ - Muon - MomentUm Orthogonalized by Newton-schulz - - Muon internally runs standard SGD-momentum, and then performs an orthogonalization post- - processing step, in which each 2D parameter's update is replaced with the nearest orthogonal - matrix. To efficiently orthogonalize each update, we use a Newton-Schulz iteration, which has - the advantage that it can be stably run in bfloat16 on the GPU. - - Some warnings: - - This optimizer assumes that all parameters passed in are 2D. - - It should not be used for the embedding layer, the final fully connected layer, or any {0,1}-D - parameters; those should all be optimized by a standard method (e.g., AdamW). - - To use it with 4D convolutional filters, it works well to just flatten their last 3 dimensions. - - We believe it is unlikely to work well for training with small batch size. - - We believe it may not work well for finetuning pretrained models, but we haven't tested this. - - We have not yet tried this optimizer for training scenarios larger than NanoGPT (124M). - - Arguments: - lr: The learning rate used by the internal SGD. - momentum: The momentum used by the internal SGD. - nesterov: Whether to use Nesterov-style momentum in the internal SGD. (recommended) - ns_steps: The number of Newton-Schulz iteration steps to use. - """ - def __init__(self, params, lr=0.02, momentum=0.95, nesterov=True, ns_steps=5): - self.world_size = int(os.environ.get('WORLD_SIZE', '1')) - self.rank = int(os.environ.get('RANK', '0')) - defaults = dict(lr=lr, momentum=momentum, nesterov=nesterov, ns_steps=ns_steps) - params = list(params) - assert all(isinstance(p, torch.Tensor) for p in params) - sizes = {p.numel() for p in params} - param_groups = [ - { - 'params': [p for p in params if p.numel() == size], - 'update_buffer': [ - torch.empty(size, device='cuda', dtype=torch.bfloat16) - for _ in range(self.world_size) - ], - } - for size in sizes - ] - super().__init__(param_groups, defaults) - - def step(self): - for group in self.param_groups: - lr = group['lr'] - momentum = group['momentum'] - nesterov = group['nesterov'] - ns_steps = group['ns_steps'] - update_buffers = group['update_buffer'] - # generate weight updates in distributed fashion - params = group['params'] - assert len(params) % self.world_size == 0 - handle = None - params_world = None - def update_prev(): - if params_world is None: - return - if handle is not None: - handle.wait() - for p_world, g_world in zip(params_world, update_buffers): - p_world.data.add_( - g_world.view_as(p_world), - alpha=-lr * max(1, p_world.size(0) / p_world.size(1)) ** 0.5, - ) - for base_i in range(len(params))[::self.world_size]: - p = params[base_i + self.rank] - g = p.grad - assert g is not None - state = self.state[p] - if 'momentum_buffer' not in state: - state['momentum_buffer'] = torch.zeros_like(g) - buf = state['momentum_buffer'] - buf.lerp_(g, 1 - momentum) - g = g.lerp_(buf, momentum) if nesterov else buf - g = zeropower_via_newtonschulz5(g, steps=ns_steps).flatten() - update_prev() - if self.world_size > 1: - handle = dist.all_gather(update_buffers, g, async_op=True) - else: - update_buffers[0].copy_(g) - handle = None - params_world = params[base_i : base_i + self.world_size] - update_prev() +from speedrunning_plms.optim import * # noqa: F401,F403 diff --git a/pyproject.toml b/pyproject.toml new file mode 100644 index 000000000..3f490f785 --- /dev/null +++ b/pyproject.toml @@ -0,0 +1,67 @@ +[build-system] +requires = ["setuptools>=68", "wheel"] +build-backend = "setuptools.build_meta" + +[project] +name = "speedrunning-plms" +version = "0.1.0" +description = "Fast protein language model training components and recipes." +readme = "README.md" +requires-python = ">=3.10" +license = { file = "LICENSE" } +authors = [ + { name = "Synthyra" }, +] +keywords = ["bioinformatics", "protein-language-models", "pytorch"] +classifiers = [ + "Development Status :: 3 - Alpha", + "Intended Audience :: Science/Research", + "License :: OSI Approved :: MIT License", + "Programming Language :: Python :: 3", + "Programming Language :: Python :: 3.10", + "Programming Language :: Python :: 3.11", + "Programming Language :: Python :: 3.12", + "Topic :: Scientific/Engineering :: Artificial Intelligence", + "Topic :: Scientific/Engineering :: Bio-Informatics", +] +dependencies = [ + "datasets>=4.5.0,<5", + "huggingface-hub>=0.34.0,<1", + "numpy>=1.26,<3", + "PyYAML>=6,<7", + "torch>=2.5", + "torchinfo>=1.8,<2", + "tqdm>=4.66,<5", + "transformers>=4.57.6,<5", +] + +[project.optional-dependencies] +training = [ + "accelerate>=1.12,<2", + "hf-transfer>=0.1.9,<0.2", + "hf-xet>=1.2,<2", + "wandb>=0.19,<1", +] +evaluation = [ + "pandas>=2,<4", + "scikit-learn>=1.5,<2", +] +test = [ + "build>=1.2,<2", + "pytest>=8,<9", +] + +[project.scripts] +speedrun-plm = "speedrunning_plms.training.cli:main" + +[project.urls] +Homepage = "https://github.com/Synthyra/SpeedrunningPLMs" +Issues = "https://github.com/Synthyra/SpeedrunningPLMs/issues" +Repository = "https://github.com/Synthyra/SpeedrunningPLMs.git" + +[tool.setuptools.packages.find] +where = ["src"] + +[tool.pytest.ini_options] +addopts = "-ra --strict-config --strict-markers" +testpaths = ["tests"] diff --git a/src/speedrunning_plms/__init__.py b/src/speedrunning_plms/__init__.py new file mode 100644 index 000000000..7d229813d --- /dev/null +++ b/src/speedrunning_plms/__init__.py @@ -0,0 +1,9 @@ +__all__ = ["PLM", "PLMConfig"] + + +def __getattr__(name: str): + if name in {"PLM", "PLMConfig"}: + from speedrunning_plms.models import PLM, PLMConfig + + return {"PLM": PLM, "PLMConfig": PLMConfig}[name] + raise AttributeError(name) diff --git a/src/speedrunning_plms/data/__init__.py b/src/speedrunning_plms/data/__init__.py new file mode 100644 index 000000000..2874227a8 --- /dev/null +++ b/src/speedrunning_plms/data/__init__.py @@ -0,0 +1,56 @@ +from speedrunning_plms.data.bin_format import ( + HEADER_SIZE, + MAGIC, + VERSION, + read_shard_num_tokens, + read_shard_tokens, + write_shard, +) +from speedrunning_plms.data.loaders import ( + AsyncBatchPipeline, + ChunkedEvalDataset, + ChunkedEvalLoader, + ChunkedTrainDataset, + ChunkedTrainLoader, + EvalLoader, + OptimizedEvalLoader, + OptimizedTrainLoader, + TrainLoader, + apply_masking_gpu, +) +from speedrunning_plms.data.packers import ChunkPacker, LegacyFlatPacker +from speedrunning_plms.data.splits import ( + build_og_prot90_splits, + build_omg_prot50_splits, + build_uniref50_splits, + push_splits, + split_train_valid_test, +) +from speedrunning_plms.data.tokens import TokenIds + +__all__ = [ + "AsyncBatchPipeline", + "ChunkedEvalDataset", + "ChunkedEvalLoader", + "ChunkedTrainDataset", + "ChunkedTrainLoader", + "ChunkPacker", + "EvalLoader", + "HEADER_SIZE", + "LegacyFlatPacker", + "MAGIC", + "OptimizedEvalLoader", + "OptimizedTrainLoader", + "TokenIds", + "TrainLoader", + "VERSION", + "apply_masking_gpu", + "build_og_prot90_splits", + "build_omg_prot50_splits", + "build_uniref50_splits", + "push_splits", + "read_shard_num_tokens", + "read_shard_tokens", + "split_train_valid_test", + "write_shard", +] diff --git a/src/speedrunning_plms/data/bin_format.py b/src/speedrunning_plms/data/bin_format.py new file mode 100644 index 000000000..38bc388d5 --- /dev/null +++ b/src/speedrunning_plms/data/bin_format.py @@ -0,0 +1,37 @@ +from pathlib import Path + +import numpy as np +import torch + +MAGIC = 20240520 +VERSION = 1 +HEADER_SIZE = 256 + + +def read_shard_num_tokens(path: str | Path) -> int: + header = torch.from_file(str(path), False, HEADER_SIZE, dtype=torch.int32) + assert header[0] == MAGIC, "magic number mismatch in the data .bin file" + assert header[1] == VERSION, "unsupported version" + return int(header[2]) + + +def read_shard_tokens(path: str | Path) -> torch.Tensor: + path = Path(path) + num_tokens = read_shard_num_tokens(path) + with path.open("rb", buffering=0) as f: + tokens = torch.empty(num_tokens, dtype=torch.uint8) + f.seek(HEADER_SIZE * 4) + nbytes = f.readinto(tokens.numpy()) + assert nbytes == num_tokens, "number of tokens read does not match header?" + return tokens + + +def write_shard(path: str | Path, tokens: np.ndarray) -> None: + assert len(tokens) < 2**31, "token count too large" + header = np.zeros(HEADER_SIZE, dtype=np.int32) + header[0] = MAGIC + header[1] = VERSION + header[2] = len(tokens) + with Path(path).open("wb") as f: + f.write(header.tobytes()) + f.write(tokens.tobytes()) diff --git a/src/speedrunning_plms/data/download.py b/src/speedrunning_plms/data/download.py new file mode 100644 index 000000000..47224e277 --- /dev/null +++ b/src/speedrunning_plms/data/download.py @@ -0,0 +1,32 @@ +import os +import argparse +from huggingface_hub import hf_hub_download + + +### Download the data from huggingface +def get(fname, data_name): + local_dir = os.path.join(os.getcwd(), "data", data_name) + if not os.path.exists(os.path.join(local_dir, fname)): + try: + print(f"Downloading {fname} from Synthyra/{data_name}_packed") + hf_hub_download(repo_id=f"Synthyra/{data_name}_packed", filename=fname, repo_type="dataset", local_dir=local_dir) + except Exception as e: + print(f"Error downloading {fname}: {e}") + else: + print(f"File {fname} already exists in {local_dir}") + + +def main(): + parser = argparse.ArgumentParser(description="Download data from huggingface") + parser.add_argument("-d", "--data_name", type=str, default="uniref50", help="Name of the dataset, uniref50, omg_prot50, or og_prot90") + parser.add_argument("-n", "--num_chunks", type=int, default=100, help="Number of chunks to download") + # each chunk is 100M tokens + args = parser.parse_args() + get(f"{args.data_name}_valid_%06d.bin" % 0, args.data_name) + get(f"{args.data_name}_test_%06d.bin" % 0, args.data_name) + for i in range(0, args.num_chunks+1): + get(f"{args.data_name}_train_%06d.bin" % i, args.data_name) + + +if __name__ == "__main__": + main() diff --git a/src/speedrunning_plms/data/loaders.py b/src/speedrunning_plms/data/loaders.py new file mode 100644 index 000000000..cd44f9c21 --- /dev/null +++ b/src/speedrunning_plms/data/loaders.py @@ -0,0 +1,945 @@ +import torch +import random +import torch.utils.data as data +from pathlib import Path +from transformers import EsmTokenizer +from typing import Tuple, Optional, List +from torch.utils.data import DataLoader, IterableDataset + +from speedrunning_plms.data.bin_format import read_shard_tokens +from speedrunning_plms.data.packers import ChunkPacker +from speedrunning_plms.data.tokens import TokenIds + + +def _coerce_token_ids(tokenizer) -> TokenIds: + if isinstance(tokenizer, TokenIds): + return tokenizer + return TokenIds.from_tokenizer(tokenizer) + + +def _load_data_shard(file: Path): + return read_shard_tokens(file) + + +class EvalLoader(IterableDataset): + """An IterableDataset specifically for evaluation that distributes data by sequences, not files.""" + + def __init__( + self, + filename_pattern: str, + seq_len: int, + process_rank: int, + num_processes: int, + tokenizer: EsmTokenizer, + ): + self.filename_pattern = filename_pattern + self.seq_len = seq_len + self.process_rank = process_rank + self.num_processes = num_processes + token_ids = _coerce_token_ids(tokenizer) + self.cls_token_id = token_ids.cls_token_id + self.eos_token_id = token_ids.eos_token_id + self.pad_token_id = token_ids.pad_token_id + self.mask_token_id = token_ids.mask_token_id + self.special_tokens = [self.cls_token_id, self.eos_token_id, self.pad_token_id] + + # All processes load all files (since we're distributing by sequences, not files) + self.all_files = sorted(Path.cwd().glob(filename_pattern)) + if not self.all_files: + raise ValueError(f"No files found matching pattern: {filename_pattern}") + + def __iter__(self): + """Generate batches, with each process taking every num_processes-th batch.""" + batch_count = 0 + + for file in self.all_files: + raw_tokens = _load_data_shard(file) + + # Process the tokens into batches + eos_positions = (raw_tokens == self.eos_token_id).nonzero(as_tuple=True)[0] + + if len(eos_positions) == 0: + continue + + # Process samples and create batches + batch_tokens = [] + curr_batch_len = 0 + + for i in range(len(eos_positions)): + curr_eos = eos_positions[i] + prev_eos_plus_one = 0 if i == 0 else eos_positions[i-1] + 1 + sample = raw_tokens[prev_eos_plus_one:curr_eos+1] + + # Handle samples that exceed batch size + if len(sample) > self.seq_len: + # Split large samples into multiple batches + for j in range(0, len(sample), self.seq_len): + chunk = sample[j:j+self.seq_len] + if len(chunk) < self.seq_len: + # Pad the last chunk + padding = torch.full((self.seq_len - len(chunk),), self.pad_token_id, dtype=torch.uint8) + chunk = torch.cat([chunk, padding]) + + # Check if this batch should be yielded by this process + if batch_count % self.num_processes == self.process_rank: + # Apply masking and yield batch + input_ids, labels, mask_rate = self._apply_masking(chunk) + yield input_ids, labels, mask_rate + batch_count += 1 + continue + + # Check if adding this sample would exceed batch size + if len(sample) + curr_batch_len > self.seq_len: + # Pad current batch and yield + if curr_batch_len > 0: + padding = torch.full((self.seq_len - curr_batch_len,), self.pad_token_id, dtype=torch.uint8) + batch_tokens.append(padding) + batch = torch.cat(batch_tokens) + + # Check if this batch should be yielded by this process + if batch_count % self.num_processes == self.process_rank: + # Apply masking and yield + input_ids, labels, mask_rate = self._apply_masking(batch) + yield input_ids, labels, mask_rate + batch_count += 1 + + # Start new batch + batch_tokens = [sample] + curr_batch_len = len(sample) + else: + # Add to current batch + batch_tokens.append(sample) + curr_batch_len += len(sample) + + # Yield complete batch + if curr_batch_len == self.seq_len: + batch = torch.cat(batch_tokens) + + # Check if this batch should be yielded by this process + if batch_count % self.num_processes == self.process_rank: + input_ids, labels, mask_rate = self._apply_masking(batch) + yield input_ids, labels, mask_rate + batch_count += 1 + batch_tokens = [] + curr_batch_len = 0 + + # Yield final incomplete batch if it exists + if curr_batch_len > 0: + padding = torch.full((self.seq_len - curr_batch_len,), self.pad_token_id, dtype=torch.uint8) + batch_tokens.append(padding) + batch = torch.cat(batch_tokens) + + # Check if this batch should be yielded by this process + if batch_count % self.num_processes == self.process_rank: + input_ids, labels, mask_rate = self._apply_masking(batch) + yield input_ids, labels, mask_rate + batch_count += 1 + + def _apply_masking(self, sequence: torch.Tensor) -> Tuple[torch.Tensor, torch.Tensor, torch.Tensor]: + """Apply masking to a sequence (on CPU).""" + # Convert to int32 + sequence = sequence.to(dtype=torch.int32) + + # Use fixed mask rate for evaluation + mask_rate = torch.full((1,), 0.15) + + # Create mask + p_mask = mask_rate.repeat(len(sequence)) + mask_indices = torch.rand(len(sequence)) < p_mask + + # Don't mask special tokens + special_mask = torch.isin(sequence, torch.tensor(self.special_tokens, dtype=torch.int32)) + mask_indices = mask_indices & ~special_mask + + # Create noisy batch and labels + noisy_batch = torch.where(mask_indices, self.mask_token_id, sequence) + labels = sequence.clone() + labels[~mask_indices] = -100 + + return noisy_batch, labels, mask_rate + + +class OptimizedEvalLoader: + """Drop-in replacement for evaluation that distributes data by sequences rather than files.""" + + def __init__( + self, + filename_pattern: str, + seq_len: int, + process_rank: int, + num_processes: int, + tokenizer: EsmTokenizer, + ): + self.filename_pattern = filename_pattern + self.seq_len = seq_len + self.process_rank = process_rank + self.num_processes = num_processes + + # Create the dataset + self._dataset = EvalLoader( + filename_pattern=filename_pattern, + seq_len=seq_len, + process_rank=process_rank, + num_processes=num_processes, + tokenizer=tokenizer, + ) + + # Store file list for compatibility - all processes see all files + self.files = self._dataset.all_files + + # Create the dataloader (single worker for evaluation to ensure deterministic order) + self.dataloader = DataLoader( + self._dataset, + batch_size=None, # Dataset returns complete batches + num_workers=0, # Single worker for deterministic eval order + pin_memory=True, # Pin memory for faster GPU transfer + ) + + # Create iterator + self._iterator = None + self._exhausted = False + + def reset(self): + """Reset the dataloader iterator.""" + self._iterator = iter(self.dataloader) + self._exhausted = False + + def next_batch(self) -> Tuple[torch.Tensor, torch.Tensor, torch.Tensor]: + """Get the next batch, ensuring GPU transfer happens here.""" + if self._iterator is None: + self.reset() + + try: + input_ids, labels, mask_rate = next(self._iterator) + # Transfer to GPU with non-blocking + input_ids = input_ids.cuda(non_blocking=True) + labels = labels.cuda(non_blocking=True) + mask_rate = mask_rate.cuda(non_blocking=True) + return input_ids, labels, mask_rate + except StopIteration: + self._exhausted = True + # Return empty tensors to signal end of data + return torch.empty(0, device='cuda'), torch.empty(0, device='cuda'), torch.empty(0, device='cuda') + + +class TrainLoader(IterableDataset): + """An IterableDataset that handles distributed padded data loading with masking.""" + + def __init__( + self, + filename_pattern: str, + seq_len: int, + process_rank: int, + num_processes: int, + max_epochs: int, + tokenizer: EsmTokenizer, + num_workers: int = 1, + mlm: bool = False, + mask_rate: float = 0.15, + ): + self.filename_pattern = filename_pattern + self.seq_len = seq_len + self.process_rank = process_rank + self.num_processes = num_processes + self.max_epochs = max_epochs + self.num_workers = num_workers + self.mask_rate = mask_rate + token_ids = _coerce_token_ids(tokenizer) + self.cls_token_id = token_ids.cls_token_id + self.eos_token_id = token_ids.eos_token_id + self.pad_token_id = token_ids.pad_token_id + self.mask_token_id = token_ids.mask_token_id + self.special_tokens = [self.cls_token_id, self.eos_token_id, self.pad_token_id] + self.mlm = mlm + # Get all files and distribute across processes (GPUs) + all_files = sorted(Path.cwd().glob(filename_pattern)) + if not all_files: + raise ValueError(f"No files found matching pattern: {filename_pattern}") + + # First distribute files across processes (GPUs) + files_per_process = len(all_files) // self.num_processes + extra_files = len(all_files) % self.num_processes + + start_idx = self.process_rank * files_per_process + min(self.process_rank, extra_files) + end_idx = start_idx + files_per_process + (1 if self.process_rank < extra_files else 0) + + self.process_files = all_files[start_idx:end_idx] + + def __iter__(self): + worker_info = data.get_worker_info() + if worker_info is None: + # Single worker mode + worker_id = 0 + num_workers = 1 + else: + worker_id = worker_info.id + num_workers = worker_info.num_workers + + # Then distribute this process's files across workers + files_per_worker = len(self.process_files) // num_workers + extra_files = len(self.process_files) % num_workers + + start_idx = worker_id * files_per_worker + min(worker_id, extra_files) + end_idx = start_idx + files_per_worker + (1 if worker_id < extra_files else 0) + + worker_files = self.process_files[start_idx:end_idx] + + # Process files cyclically for multiple epochs + epoch = 0 + file_idx = 0 + leftover_tokens = torch.empty(0, dtype=torch.uint8) + + while epoch < self.max_epochs: + # Shuffle files at the start of each epoch + if file_idx == 0 and epoch > 0: + # Include process rank for proper distributed shuffling + random.seed(epoch + self.process_rank * 10000 + worker_id * 1000) + random.shuffle(worker_files) + + # Load current file + if file_idx < len(worker_files): + raw_tokens = _load_data_shard(worker_files[file_idx]) + raw_tokens = torch.cat([leftover_tokens, raw_tokens], dim=0) + file_idx += 1 + else: + # End of epoch + if leftover_tokens.numel() == 0: + epoch += 1 + file_idx = 0 + continue + raw_tokens = leftover_tokens + leftover_tokens = torch.empty(0, dtype=torch.uint8) + + # Process the tokens into batches + eos_positions = (raw_tokens == self.eos_token_id).nonzero(as_tuple=True)[0] + + if len(eos_positions) == 0: + leftover_tokens = raw_tokens + if file_idx >= len(worker_files): + epoch += 1 + file_idx = 0 + continue + + # Process samples and create batches + batch_tokens = [] + curr_batch_len = 0 + + for i in range(len(eos_positions)): + curr_eos = eos_positions[i] + prev_eos_plus_one = 0 if i == 0 else eos_positions[i-1] + 1 + sample = raw_tokens[prev_eos_plus_one:curr_eos+1] + + # Handle samples that exceed batch size + if len(sample) > self.seq_len: + # Split large samples into multiple batches + for j in range(0, len(sample), self.seq_len): + chunk = sample[j:j+self.seq_len] + if len(chunk) < self.seq_len: + # Pad the last chunk + padding = torch.full((self.seq_len - len(chunk),), self.pad_token_id, dtype=torch.uint8) + chunk = torch.cat([chunk, padding]) + + # Apply masking and yield batch + input_ids, labels, mask_rate = self._apply_masking(chunk) + yield input_ids, labels, mask_rate + continue + + # Check if adding this sample would exceed batch size + if len(sample) + curr_batch_len > self.seq_len: + # Pad current batch and yield + if curr_batch_len > 0: + padding = torch.full((self.seq_len - curr_batch_len,), self.pad_token_id, dtype=torch.uint8) + batch_tokens.append(padding) + batch = torch.cat(batch_tokens) + + # Apply masking and yield + input_ids, labels, mask_rate = self._apply_masking(batch) + yield input_ids, labels, mask_rate + + # Start new batch + batch_tokens = [sample] + curr_batch_len = len(sample) + else: + # Add to current batch + batch_tokens.append(sample) + curr_batch_len += len(sample) + + # Yield complete batch + if curr_batch_len == self.seq_len: + batch = torch.cat(batch_tokens) + input_ids, labels, mask_rate = self._apply_masking(batch) + yield input_ids, labels, mask_rate + batch_tokens = [] + curr_batch_len = 0 + + # Save leftover tokens for next file + if len(eos_positions) > 0: + leftover_tokens = raw_tokens[eos_positions[-1]+1:] + + # Yield final incomplete batch if at end of epoch + if file_idx >= len(worker_files) and curr_batch_len > 0: + padding = torch.full((self.seq_len - curr_batch_len,), self.pad_token_id, dtype=torch.uint8) + batch_tokens.append(padding) + batch = torch.cat(batch_tokens) + input_ids, labels, mask_rate = self._apply_masking(batch) + yield input_ids, labels, mask_rate + + epoch += 1 + file_idx = 0 + + def _apply_masking(self, sequence: torch.Tensor) -> Tuple[torch.Tensor, torch.Tensor, torch.Tensor]: + """Apply masking to a sequence (on CPU).""" + # Convert to int32 + sequence = sequence.to(dtype=torch.int32) + + # Pick mask rate + if self.mlm: + mask_rate = torch.full((1,), self.mask_rate) + else: + eps = 1e-3 + mask_rate = torch.rand(1) + mask_rate = (1 - eps) * mask_rate + eps + + # Create mask + p_mask = mask_rate.repeat(len(sequence)) + mask_indices = torch.rand(len(sequence)) < p_mask + + # Don't mask special tokens + special_mask = torch.isin(sequence, torch.tensor(self.special_tokens, dtype=torch.int32)) + mask_indices = mask_indices & ~special_mask + + # Create noisy batch and labels + noisy_batch = torch.where(mask_indices, self.mask_token_id, sequence) + labels = sequence.clone() + labels[~mask_indices] = -100 + + return noisy_batch, labels, mask_rate + + +class OptimizedTrainLoader: + """Drop-in replacement for DistributedPaddedDataLoader using multi-worker optimization.""" + + def __init__( + self, + filename_pattern: str, + seq_len: int, + process_rank: int, + num_processes: int, + max_epochs: int, + tokenizer: EsmTokenizer, + num_workers: int = 4, + prefetch_factor: int = 2, + mlm: bool = False, + mask_rate: float = 0.15, + ): + self.filename_pattern = filename_pattern + self.seq_len = seq_len + self.process_rank = process_rank + self.num_processes = num_processes + self.mlm = mlm + self.mask_rate = mask_rate + + # Create the dataset to get file count + self._dataset = TrainLoader( + filename_pattern=filename_pattern, + seq_len=seq_len, + process_rank=process_rank, + num_processes=num_processes, + max_epochs=max_epochs, + tokenizer=tokenizer, + num_workers=num_workers, + mlm=mlm, + mask_rate=mask_rate, + ) + + # Store file list for compatibility - only this process's files + self.files = self._dataset.process_files + + # Create the optimized dataloader + self.dataloader = DataLoader( + self._dataset, + batch_size=None, # Dataset returns complete batches + num_workers=num_workers, + pin_memory=True, # Pin memory for faster GPU transfer + prefetch_factor=prefetch_factor if num_workers > 0 else None, + persistent_workers=True if num_workers > 0 else False, # Keep workers alive between epochs + ) + + # Create iterator + self._iterator = None + self._exhausted = False + + def set_mask_rate(self, mask_rate: float): + """Set the mask rate for the next batch(es).""" + self.mask_rate = mask_rate + self._dataset.mask_rate = mask_rate + + def set_mlm(self, mlm: bool): + """Set whether to use MLM masking in the dataset.""" + self.mlm = mlm + self._dataset.mlm = mlm + + def reset(self): + """Reset the dataloader iterator.""" + self._iterator = iter(self.dataloader) + self._exhausted = False + + def next_batch(self) -> Tuple[torch.Tensor, torch.Tensor, torch.Tensor]: + """Get the next batch, ensuring GPU transfer happens here.""" + if self._iterator is None: + self.reset() + + try: + input_ids, labels, mask_rate = next(self._iterator) + # Transfer to GPU with non-blocking + input_ids = input_ids.cuda(non_blocking=True) + labels = labels.cuda(non_blocking=True) + mask_rate = mask_rate.cuda(non_blocking=True) + return input_ids, labels, mask_rate + except StopIteration: + self._exhausted = True + # Return empty tensors to signal end of data + return torch.empty(0, device='cuda'), torch.empty(0, device='cuda'), torch.empty(0, device='cuda') + + +# ======================================================================================== +# Chunk-aligned data loaders (new for batched UNet + GPU-side masking) +# ======================================================================================== + + +class ChunkedTrainDataset(IterableDataset): + """Chunk-aligned IterableDataset that packs documents into fixed-length chunks. + + Each chunk is exactly max_length tokens with documents packed end-to-end. + No document spans a chunk boundary. If a document doesn't fit in the current + chunk, the remainder is padded and a new chunk starts. Documents exceeding + max_length are truncated to their own chunk. + + Yields batches of (B, max_length) int32 tensors containing raw input_ids + (no masking applied -- masking is done on GPU in the training loop). + """ + + def __init__( + self, + filename_pattern: str, + max_length: int, + batch_size: int, + process_rank: int, + num_processes: int, + max_epochs: int, + tokenizer: EsmTokenizer, + num_workers: int = 1, + ): + self.filename_pattern = filename_pattern + self.max_length = max_length + self.batch_size = batch_size + self.process_rank = process_rank + self.num_processes = num_processes + self.max_epochs = max_epochs + self.num_workers = num_workers + token_ids = _coerce_token_ids(tokenizer) + self.cls_token_id = token_ids.cls_token_id + self.eos_token_id = token_ids.eos_token_id + self.pad_token_id = token_ids.pad_token_id + + all_files = sorted(Path.cwd().glob(filename_pattern)) + assert len(all_files) > 0, f"No files found matching pattern: {filename_pattern}" + + # Distribute files across processes (GPUs) + files_per_process = len(all_files) // num_processes + extra = len(all_files) % num_processes + start = process_rank * files_per_process + min(process_rank, extra) + end = start + files_per_process + (1 if process_rank < extra else 0) + self.process_files = all_files[start:end] + + def _pack_chunks(self, raw_tokens: torch.Tensor): + """Pack raw tokens into max_length-aligned chunks. + + Documents are delineated by EOS tokens. Each chunk contains one or more + complete documents, padded at the end if needed. + + Yields individual (max_length,) uint8 chunks. + """ + yield from ChunkPacker( + max_length=self.max_length, + eos_token_id=self.eos_token_id, + pad_token_id=self.pad_token_id, + ).pack(raw_tokens) + + def __iter__(self): + worker_info = data.get_worker_info() + if worker_info is None: + worker_id = 0 + num_workers = 1 + else: + worker_id = worker_info.id + num_workers = worker_info.num_workers + + # Distribute this process's files across workers + files_per_worker = len(self.process_files) // num_workers + extra = len(self.process_files) % num_workers + start = worker_id * files_per_worker + min(worker_id, extra) + end = start + files_per_worker + (1 if worker_id < extra else 0) + worker_files = list(self.process_files[start:end]) + + epoch = 0 + leftover_tokens = torch.empty(0, dtype=torch.uint8) + batch_chunks: List[torch.Tensor] = [] + + while epoch < self.max_epochs: + file_idx = 0 + + if epoch > 0: + random.seed(epoch + self.process_rank * 10000 + worker_id * 1000) + random.shuffle(worker_files) + + while file_idx < len(worker_files): + raw_tokens = _load_data_shard(worker_files[file_idx]) + raw_tokens = torch.cat([leftover_tokens, raw_tokens]) + file_idx += 1 + + # Find last complete document + eos_positions = (raw_tokens == self.eos_token_id).nonzero(as_tuple=True)[0] + if len(eos_positions) == 0: + leftover_tokens = raw_tokens + continue + + last_eos_pos = eos_positions[-1].item() + leftover_tokens = raw_tokens[last_eos_pos + 1:] + complete_tokens = raw_tokens[:last_eos_pos + 1] + + for chunk in self._pack_chunks(complete_tokens): + batch_chunks.append(chunk.to(torch.int32)) + if len(batch_chunks) == self.batch_size: + yield torch.stack(batch_chunks) # (B, max_length) + batch_chunks = [] + + # End of epoch: drop incomplete batch, reset + leftover_tokens = torch.empty(0, dtype=torch.uint8) + batch_chunks = [] + epoch += 1 + + +class ChunkedTrainLoader: + """Chunk-aligned training data loader. + + Yields (B, max_length) int32 tensors of raw input_ids on CPU (pinned memory). + No masking applied -- masking is handled on GPU in the training loop. + """ + + def __init__( + self, + filename_pattern: str, + max_length: int, + micro_batch_tokens: int, + process_rank: int, + num_processes: int, + max_epochs: int, + tokenizer: EsmTokenizer, + num_workers: int = 4, + prefetch_factor: int = 2, + ): + self.max_length = max_length + batch_size = micro_batch_tokens // max_length + assert batch_size >= 1, f"micro_batch_tokens ({micro_batch_tokens}) must be >= max_length ({max_length})" + + self._dataset = ChunkedTrainDataset( + filename_pattern=filename_pattern, + max_length=max_length, + batch_size=batch_size, + process_rank=process_rank, + num_processes=num_processes, + max_epochs=max_epochs, + tokenizer=tokenizer, + num_workers=num_workers, + ) + self.files = self._dataset.process_files + + self.dataloader = DataLoader( + self._dataset, + batch_size=None, + num_workers=num_workers, + pin_memory=True, + prefetch_factor=prefetch_factor if num_workers > 0 else None, + persistent_workers=True if num_workers > 0 else False, + ) + self._iterator = None + self._exhausted = False + + def reset(self): + """Reset the dataloader iterator.""" + self._iterator = iter(self.dataloader) + self._exhausted = False + + def next_batch(self) -> torch.Tensor: + """Get next batch of raw input_ids (B, max_length) on CPU (pinned memory).""" + if self._iterator is None: + self.reset() + + try: + return next(self._iterator) + except StopIteration: + self._exhausted = True + return torch.empty(0, dtype=torch.int32) + + +class ChunkedEvalDataset(IterableDataset): + """Chunk-aligned evaluation dataset. Same packing as training but: + - All processes see all files (distributes by sequence, not file) + - Single epoch only + - Yields (B, max_length) int32 raw input_ids + """ + + def __init__( + self, + filename_pattern: str, + max_length: int, + batch_size: int, + process_rank: int, + num_processes: int, + tokenizer: EsmTokenizer, + ): + self.filename_pattern = filename_pattern + self.max_length = max_length + self.batch_size = batch_size + self.process_rank = process_rank + self.num_processes = num_processes + token_ids = _coerce_token_ids(tokenizer) + self.eos_token_id = token_ids.eos_token_id + self.pad_token_id = token_ids.pad_token_id + + self.all_files = sorted(Path.cwd().glob(filename_pattern)) + assert len(self.all_files) > 0, f"No files found matching pattern: {filename_pattern}" + + def __iter__(self): + """Generate batches, with each process taking every num_processes-th batch.""" + batch_count = 0 + batch_chunks: List[torch.Tensor] = [] + + for file in self.all_files: + raw_tokens = _load_data_shard(file) + + eos_positions = (raw_tokens == self.eos_token_id).nonzero(as_tuple=True)[0] + if len(eos_positions) == 0: + continue + + chunk_parts: List[torch.Tensor] = [] + chunk_len = 0 + prev_start = 0 + + for i in range(len(eos_positions)): + curr_eos = eos_positions[i].item() + doc = raw_tokens[prev_start:curr_eos + 1] + prev_start = curr_eos + 1 + doc_len = len(doc) + + if doc_len > self.max_length: + if chunk_len > 0: + padding = torch.full((self.max_length - chunk_len,), self.pad_token_id, dtype=torch.uint8) + batch_chunks.append(torch.cat(chunk_parts + [padding]).to(torch.int32)) + chunk_parts = [] + chunk_len = 0 + if len(batch_chunks) == self.batch_size: + if batch_count % self.num_processes == self.process_rank: + yield torch.stack(batch_chunks) + batch_count += 1 + batch_chunks = [] + batch_chunks.append(doc[:self.max_length].clone().to(torch.int32)) + if len(batch_chunks) == self.batch_size: + if batch_count % self.num_processes == self.process_rank: + yield torch.stack(batch_chunks) + batch_count += 1 + batch_chunks = [] + continue + + if doc_len + chunk_len > self.max_length: + padding = torch.full((self.max_length - chunk_len,), self.pad_token_id, dtype=torch.uint8) + batch_chunks.append(torch.cat(chunk_parts + [padding]).to(torch.int32)) + chunk_parts = [] + chunk_len = 0 + if len(batch_chunks) == self.batch_size: + if batch_count % self.num_processes == self.process_rank: + yield torch.stack(batch_chunks) + batch_count += 1 + batch_chunks = [] + + chunk_parts.append(doc) + chunk_len += doc_len + + if chunk_len == self.max_length: + batch_chunks.append(torch.cat(chunk_parts).to(torch.int32)) + chunk_parts = [] + chunk_len = 0 + if len(batch_chunks) == self.batch_size: + if batch_count % self.num_processes == self.process_rank: + yield torch.stack(batch_chunks) + batch_count += 1 + batch_chunks = [] + + # Flush remaining chunk from this file + if chunk_len > 0: + padding = torch.full((self.max_length - chunk_len,), self.pad_token_id, dtype=torch.uint8) + batch_chunks.append(torch.cat(chunk_parts + [padding]).to(torch.int32)) + if len(batch_chunks) == self.batch_size: + if batch_count % self.num_processes == self.process_rank: + yield torch.stack(batch_chunks) + batch_count += 1 + batch_chunks = [] + + # Drop partial batches to maintain fixed (B, max_length) shape + + +class ChunkedEvalLoader: + """Chunk-aligned evaluation loader. + + Yields (B, max_length) int32 tensors of raw input_ids on CPU. + Distributes data by sequence across processes. + """ + + def __init__( + self, + filename_pattern: str, + max_length: int, + micro_batch_tokens: int, + process_rank: int, + num_processes: int, + tokenizer: EsmTokenizer, + ): + self.max_length = max_length + batch_size = micro_batch_tokens // max_length + assert batch_size >= 1, f"micro_batch_tokens ({micro_batch_tokens}) must be >= max_length ({max_length})" + + self._dataset = ChunkedEvalDataset( + filename_pattern=filename_pattern, + max_length=max_length, + batch_size=batch_size, + process_rank=process_rank, + num_processes=num_processes, + tokenizer=tokenizer, + ) + self.files = self._dataset.all_files + + self.dataloader = DataLoader( + self._dataset, + batch_size=None, + num_workers=0, + pin_memory=True, + ) + self._iterator = None + self._exhausted = False + + def reset(self): + """Reset the dataloader iterator.""" + self._iterator = iter(self.dataloader) + self._exhausted = False + + def next_batch(self) -> torch.Tensor: + """Get next batch of raw input_ids (B, max_length) on CPU.""" + if self._iterator is None: + self.reset() + + try: + return next(self._iterator) + except StopIteration: + self._exhausted = True + return torch.empty(0, dtype=torch.int32) + + +def apply_masking_gpu( + input_ids: torch.Tensor, + special_tokens: torch.Tensor, + mask_token_id: int, + mask_rate: float, + mlm: bool = False, +): + """Apply masking on GPU -- much faster than CPU, no worker sync issues. + + Args: + input_ids: (B, L) or (L,) raw token IDs on GPU + special_tokens: 1D tensor of token IDs to never mask (CLS, EOS, PAD) + mask_token_id: Token ID to replace masked positions with + mask_rate: Maximum mask rate (for MLM, used directly; for MD, sampled uniformly) + mlm: If True, use fixed mask_rate. If False, sample uniform rate (masked diffusion). + + Returns: + noisy: input_ids with masked positions replaced by mask_token_id + labels: original token IDs at masked positions, -100 elsewhere + rate: scalar tensor of the actual mask rate used + """ + if mlm: + rate = torch.tensor(mask_rate, device=input_ids.device, dtype=torch.float32) + else: + eps = 1e-3 + rate = torch.rand(1, device=input_ids.device) * (1 - eps) + eps + + mask_probs = torch.rand_like(input_ids, dtype=torch.float32) + mask_indices = mask_probs < rate + + # Don't mask special tokens + special_mask = torch.isin(input_ids, special_tokens) + mask_indices = mask_indices & ~special_mask + + labels = input_ids.clone() + labels[~mask_indices] = -100 + noisy = torch.where(mask_indices, mask_token_id, input_ids) + return noisy, labels, rate + + +class AsyncBatchPipeline: + """Double-buffered CUDA stream pipeline for overlapping H2D transfer with compute. + + Wraps a data loader that yields CPU tensors. Uses a background CUDA stream + to transfer the next batch while the current batch is being processed on + the default stream. + """ + + def __init__(self, loader): + """ + Args: + loader: A data loader with .next_batch() returning CPU tensors + and ._exhausted attribute. + """ + self.loader = loader + self.files = loader.files + self.transfer_stream = torch.cuda.Stream() + self._next_batch = None + self._exhausted = False + + def reset(self): + """Reset the underlying loader and pre-fetch the first batch.""" + self.loader.reset() + self._exhausted = False + self._next_batch = None + self._prefetch() + + def _prefetch(self): + """Transfer the next batch to GPU on the background stream.""" + raw = self.loader.next_batch() + if raw.numel() == 0: + self._exhausted = True + self._next_batch = None + return + with torch.cuda.stream(self.transfer_stream): + self._next_batch = raw.cuda(non_blocking=True) + + def next_batch(self) -> torch.Tensor: + """Return the pre-staged GPU batch and start transferring the next one. + + Returns: + input_ids on GPU (B, max_length) int32, or empty tensor if exhausted. + """ + if self._next_batch is None: + if self._exhausted: + return torch.empty(0, dtype=torch.int32, device='cuda') + self._prefetch() + if self._next_batch is None: + return torch.empty(0, dtype=torch.int32, device='cuda') + + # Wait for the transfer to complete + torch.cuda.current_stream().wait_stream(self.transfer_stream) + batch = self._next_batch + + # Start prefetching the next batch + self._prefetch() + + return batch diff --git a/src/speedrunning_plms/data/packers.py b/src/speedrunning_plms/data/packers.py new file mode 100644 index 000000000..463231eda --- /dev/null +++ b/src/speedrunning_plms/data/packers.py @@ -0,0 +1,68 @@ +from dataclasses import dataclass +from typing import Iterable, List + +import torch + + +@dataclass(frozen=True) +class ChunkPacker: + max_length: int + eos_token_id: int + pad_token_id: int + + def pack(self, raw_tokens: torch.Tensor) -> Iterable[torch.Tensor]: + eos_positions = (raw_tokens == self.eos_token_id).nonzero(as_tuple=True)[0] + if len(eos_positions) == 0: + return + + chunk_parts: List[torch.Tensor] = [] + chunk_len = 0 + + prev_start = 0 + for i in range(len(eos_positions)): + curr_eos = eos_positions[i].item() + doc = raw_tokens[prev_start:curr_eos + 1] + prev_start = curr_eos + 1 + doc_len = len(doc) + + if doc_len > self.max_length: + if chunk_len > 0: + padding = torch.full((self.max_length - chunk_len,), self.pad_token_id, dtype=torch.uint8) + yield torch.cat(chunk_parts + [padding]) + chunk_parts = [] + chunk_len = 0 + yield doc[:self.max_length].clone() + continue + + if doc_len + chunk_len > self.max_length: + padding = torch.full((self.max_length - chunk_len,), self.pad_token_id, dtype=torch.uint8) + yield torch.cat(chunk_parts + [padding]) + chunk_parts = [] + chunk_len = 0 + + chunk_parts.append(doc) + chunk_len += doc_len + + if chunk_len == self.max_length: + yield torch.cat(chunk_parts) + chunk_parts = [] + chunk_len = 0 + + if chunk_len > 0: + padding = torch.full((self.max_length - chunk_len,), self.pad_token_id, dtype=torch.uint8) + yield torch.cat(chunk_parts + [padding]) + + +@dataclass(frozen=True) +class LegacyFlatPacker: + seq_len: int + eos_token_id: int + pad_token_id: int + + def split_oversized(self, sample: torch.Tensor) -> Iterable[torch.Tensor]: + for j in range(0, len(sample), self.seq_len): + chunk = sample[j:j + self.seq_len] + if len(chunk) < self.seq_len: + padding = torch.full((self.seq_len - len(chunk),), self.pad_token_id, dtype=torch.uint8) + chunk = torch.cat([chunk, padding]) + yield chunk diff --git a/src/speedrunning_plms/data/splits.py b/src/speedrunning_plms/data/splits.py new file mode 100644 index 000000000..c68c89675 --- /dev/null +++ b/src/speedrunning_plms/data/splits.py @@ -0,0 +1,48 @@ +from datasets import DatasetDict, concatenate_datasets, load_dataset + +SHUFFLE_SEED = 11 +HOLDOUT_SEED = 22 +VALID_TEST_SEED = 33 + + +def login_if_token(hf_token: str | None) -> None: + if hf_token: + import huggingface_hub + + huggingface_hub.login(token=hf_token) + + +def split_train_valid_test(data): + data = data.train_test_split(test_size=20000, seed=HOLDOUT_SEED) + train = data["train"] + valid = data["test"].train_test_split(test_size=10000, seed=VALID_TEST_SEED) + return DatasetDict({ + "train": train, + "valid": valid["train"], + "test": valid["test"], + }) + + +def build_uniref50_splits(): + data = load_dataset("agemagician/uniref50_09012025") + data = data.remove_columns("id").remove_columns("name").shuffle(seed=SHUFFLE_SEED) + data = data.rename_column("text", "sequence") + data = concatenate_datasets([data["train"], data["validation"], data["test"]]) + return split_train_valid_test(data) + + +def build_omg_prot50_splits(): + data = load_dataset("tattabio/OMG_prot50", split="train") + data = data.remove_columns("id").shuffle(seed=SHUFFLE_SEED) + return split_train_valid_test(data) + + +def build_og_prot90_splits(): + data = load_dataset("tattabio/OG_prot90", split="train") + data = data.remove_columns("id").shuffle(seed=SHUFFLE_SEED) + return split_train_valid_test(data) + + +def push_splits(dataset: DatasetDict, repo_id: str) -> None: + print(dataset) + dataset.push_to_hub(repo_id) diff --git a/src/speedrunning_plms/data/tokenize.py b/src/speedrunning_plms/data/tokenize.py new file mode 100644 index 000000000..03aeb09b5 --- /dev/null +++ b/src/speedrunning_plms/data/tokenize.py @@ -0,0 +1,220 @@ +""" +example doc to highlight the structure of the dataset: +{ + "sequence": "MYDSNIFEKVNQYKFLYIWWLIMINVNH" +} +""" +import os +import argparse +import multiprocessing as mp +import numpy as np +import glob +from functools import partial +from transformers import EsmTokenizer +from datasets import load_dataset +from tqdm import tqdm + +from speedrunning_plms.data.bin_format import write_shard + + +def upload_folder_to_hf(folder_path, repo_id, repo_type="dataset", token=None): + """ + Upload an entire folder to Hugging Face Hub (bulk upload to avoid rate limiting) + + Benefits: + - Uploads all files in a single operation instead of individual requests + - Automatically handles large uploads with multi-commit strategy + - Reduces API rate limiting issues + - More efficient for large numbers of files + """ + if repo_id is None: + print(f"Skipping upload for {folder_path} - no repo_id specified") + return + + try: + from huggingface_hub import HfApi + api = HfApi() + + print(f"Uploading folder {folder_path} to {repo_id}...") + + # Create repository if it doesn't exist + try: + api.create_repo( + repo_id=repo_id, + repo_type=repo_type, + token=token, + exist_ok=True + ) + print(f"Repository {repo_id} ready") + except Exception as e: + print(f"Repository might already exist: {e}") + + # Count files to upload + file_count = len([f for f in os.listdir(folder_path) if f.endswith('.bin')]) + print(f"Found {file_count} files to upload") + + # Try to use multi_commits for large uploads (if supported) + try: + if file_count > 100: # Use multi-commit for large uploads + print("Using multi-commit upload for large number of files...") + api.upload_folder( + folder_path=folder_path, + repo_id=repo_id, + repo_type=repo_type, + token=token, + multi_commits=True, + multi_commits_verbose=True + ) + else: + # Standard upload for smaller sets + api.upload_folder( + folder_path=folder_path, + repo_id=repo_id, + repo_type=repo_type, + token=token + ) + except TypeError as e: + if "multi_commits" in str(e): + print("multi_commits not supported in this version of huggingface_hub, using standard upload...") + # Fall back to standard upload + api.upload_folder( + folder_path=folder_path, + repo_id=repo_id, + repo_type=repo_type, + token=token + ) + else: + raise e + + print(f"Successfully uploaded folder {folder_path} to {repo_id}") + + except Exception as e: + print(f"Error uploading folder {folder_path}: {e}") + + +def write_datafile(filename, toks): + """ + Saves token data as a .bin file, for reading in C. + - First comes a header with 256 int32s + - The tokens follow, each as a uint8 + """ + print(f"\nwriting {len(toks):,} tokens to {filename}") + write_shard(filename, toks) + + +def tokenize(doc, tokenizer, max_length): + # tokenizes a single document and returns a numpy array of uint8 tokens + # uint8 can hold the 33 tokens + return np.array(tokenizer.encode(doc["sequence"], add_special_tokens=True, truncation=True, padding=False, max_length=max_length), dtype=np.uint8) + + +def tokenize_fw( + fw, + split='train', + data_name='omgprot50', + max_length=1024, + upload_repo=None, + token=None, + shard_size=None, + data_cache_dir=None, +): + # tokenize all documents and write output shards, each of approximately shard_size tokens + # ensures each shard contains complete sequences only + + # Check if .bin files already exist for this dataset/split + if shard_size is None: + shard_size = 10**8 + if data_cache_dir is None: + data_cache_dir = os.path.join(os.getcwd(), "data", data_name) + + existing_files = glob.glob(os.path.join(data_cache_dir, f"{data_name}_{split}_*.bin")) + + if existing_files: + print(f"Found {len(existing_files)} existing .bin files for {data_name}_{split}") + print("Skipping tokenization and proceeding to upload...") + + # Upload existing files if upload_repo is specified + if upload_repo: + upload_folder_to_hf(data_cache_dir, upload_repo, token=token) + else: + print("No upload repository specified, files are ready locally") + return + + print(f"No existing .bin files found for {data_name}_{split}, proceeding with tokenization...") + + tokenizer = EsmTokenizer.from_pretrained("facebook/esm2_t6_8M_UR50D") + nprocs = max(1, os.cpu_count() - 2) # don't hog the entire system + with mp.Pool(nprocs) as pool: + shard_index = 0 + current_shard = [] + current_size = 0 + progress_bar = None + tokenize_fn = partial(tokenize, tokenizer=tokenizer, max_length=max_length) + + for tokens in pool.imap(tokenize_fn, fw, chunksize=16): + # Update progress bar + if progress_bar is None: + progress_bar = tqdm(total=shard_size, unit="tokens", desc=f"Shard {shard_index}") + + # If adding this sequence would exceed shard size, write current shard and start new one + if current_size + len(tokens) > shard_size and current_size > 0: + # Convert accumulated tokens to numpy array and write + all_tokens_np = np.concatenate(current_shard) + filename = os.path.join(data_cache_dir, f"{data_name}_{split}_{shard_index:06d}.bin") + write_datafile(filename, all_tokens_np) + + # Reset for next shard + shard_index += 1 + current_shard = [] + current_size = 0 + progress_bar = None + + # Add sequence to current shard + current_shard.append(tokens) + current_size += len(tokens) + if progress_bar: + progress_bar.update(len(tokens)) + + # Write final shard if there are remaining sequences + if current_size > 0: + all_tokens_np = np.concatenate(current_shard) + filename = os.path.join(data_cache_dir, f"{data_name}_{split}_{shard_index:06d}.bin") + write_datafile(filename, all_tokens_np) + + # Upload all files at once after tokenization is complete + if upload_repo: + upload_folder_to_hf(data_cache_dir, upload_repo, token=token) + + +parser = argparse.ArgumentParser(description="OMGprot50 dataset preprocessing") +parser.add_argument("-s", "--shard_size", type=int, default=10**8, help="Size of each shard in tokens") +parser.add_argument("-m", "--max_length", type=int, default=1024, help="Maximum sequence length") +parser.add_argument("-d", "--data_name", type=str, default="omg_prot50", help="Name of the dataset") +parser.add_argument("-r", "--upload_repo", type=str, default=None, help="Hugging Face repository ID to upload to (e.g., 'username/repo_name')") +parser.add_argument("-t", "--hf_token", type=str, default=None, help="Hugging Face token for authentication (or set token environment variable)") + + +def main(): + args = parser.parse_args() + data_name = args.data_name + + # Get HF token from args or environment + token = args.hf_token or os.environ.get("token") + if args.upload_repo and not token: + print("Warning: Upload repository specified but no HF token provided. Set --hf_token or token environment variable.") + + # create the cache the local directory if it doesn't exist yet + DATA_CACHE_DIR = os.path.join(os.getcwd(), "data", data_name) + os.makedirs(DATA_CACHE_DIR, exist_ok=True) + + # download the dataset + train_fw = load_dataset(f"Synthyra/{data_name}", split="train") + valid_fw = load_dataset(f"Synthyra/{data_name}", split="valid") + test_fw = load_dataset(f"Synthyra/{data_name}", split="test") + tokenize_fw(valid_fw, split='valid', data_name=data_name, max_length=args.max_length, upload_repo=args.upload_repo, token=token, shard_size=args.shard_size, data_cache_dir=DATA_CACHE_DIR) + tokenize_fw(test_fw, split='test', data_name=data_name, max_length=args.max_length, upload_repo=args.upload_repo, token=token, shard_size=args.shard_size, data_cache_dir=DATA_CACHE_DIR) + tokenize_fw(train_fw, split='train', data_name=data_name, max_length=100000, upload_repo=args.upload_repo, token=token, shard_size=args.shard_size, data_cache_dir=DATA_CACHE_DIR) # don't trim training data + + +if __name__ == "__main__": + main() diff --git a/src/speedrunning_plms/data/tokens.py b/src/speedrunning_plms/data/tokens.py new file mode 100644 index 000000000..1be2b1dd4 --- /dev/null +++ b/src/speedrunning_plms/data/tokens.py @@ -0,0 +1,18 @@ +from dataclasses import dataclass + + +@dataclass(frozen=True) +class TokenIds: + cls_token_id: int + eos_token_id: int + pad_token_id: int + mask_token_id: int + + @classmethod + def from_tokenizer(cls, tokenizer) -> "TokenIds": + return cls( + cls_token_id=tokenizer.cls_token_id, + eos_token_id=tokenizer.eos_token_id, + pad_token_id=tokenizer.pad_token_id, + mask_token_id=tokenizer.mask_token_id, + ) diff --git a/src/speedrunning_plms/evaluation/__init__.py b/src/speedrunning_plms/evaluation/__init__.py new file mode 100644 index 000000000..0158b5c4e --- /dev/null +++ b/src/speedrunning_plms/evaluation/__init__.py @@ -0,0 +1,15 @@ +"""Reproducible evaluation helpers.""" + +from speedrunning_plms.evaluation.benchmark_assets import ( + download_dataset_split, + load_benchmark_manifest, + load_benchmark_model, + load_benchmark_tokenizer, +) + +__all__ = [ + "download_dataset_split", + "load_benchmark_manifest", + "load_benchmark_model", + "load_benchmark_tokenizer", +] diff --git a/src/speedrunning_plms/evaluation/benchmark_assets.py b/src/speedrunning_plms/evaluation/benchmark_assets.py new file mode 100644 index 000000000..a7ab90ef8 --- /dev/null +++ b/src/speedrunning_plms/evaluation/benchmark_assets.py @@ -0,0 +1,92 @@ +"""Load benchmark assets only at manifest-pinned Hub commits.""" + +import json +import re +from pathlib import Path +from typing import Any, Callable, Mapping + + +FULL_COMMIT_SHA = re.compile(r"^[0-9a-f]{40}$") + + +def _validate_asset(asset: Mapping[str, Any], *, label: str) -> None: + repo_id = asset.get("repo_id") + revision = asset.get("revision") + if not isinstance(repo_id, str) or "/" not in repo_id: + raise ValueError(f"{label}.repo_id must be a Hugging Face repository ID.") + if not isinstance(revision, str) or not FULL_COMMIT_SHA.fullmatch(revision): + raise ValueError(f"{label}.revision must be a full 40-character commit SHA.") + + +def load_benchmark_manifest(path: str | Path) -> dict[str, Any]: + """Read and validate an immutable benchmark asset manifest.""" + manifest = json.loads(Path(path).read_text(encoding="utf-8")) + if manifest.get("schema_version") != 1: + raise ValueError("Unsupported benchmark manifest schema_version.") + + tokenizer = manifest.get("tokenizer") + models = manifest.get("models") + datasets = manifest.get("datasets") + if not isinstance(tokenizer, dict): + raise ValueError("Benchmark manifest requires one tokenizer asset.") + if not isinstance(models, list) or not models: + raise ValueError("Benchmark manifest requires at least one model asset.") + if not isinstance(datasets, list) or not datasets: + raise ValueError("Benchmark manifest requires at least one dataset asset.") + + _validate_asset(tokenizer, label="tokenizer") + for index, model in enumerate(models): + _validate_asset(model, label=f"models[{index}]") + if not model.get("nickname"): + raise ValueError(f"models[{index}].nickname is required.") + for index, dataset in enumerate(datasets): + _validate_asset(dataset, label=f"datasets[{index}]") + if not dataset.get("name"): + raise ValueError(f"datasets[{index}].name is required.") + filename = dataset.get("filename") + if not isinstance(filename, str) or "{split}" not in filename: + raise ValueError( + f"datasets[{index}].filename must contain the {{split}} placeholder." + ) + + model_names = [model["nickname"] for model in models] + dataset_names = [dataset["name"] for dataset in datasets] + if len(model_names) != len(set(model_names)): + raise ValueError("Model nicknames must be unique.") + if len(dataset_names) != len(set(dataset_names)): + raise ValueError("Dataset names must be unique.") + return manifest + + +def download_dataset_split( + asset: Mapping[str, Any], + split: str, + *, + downloader: Callable, +): + """Download one dataset split at its pinned manifest revision.""" + return downloader( + repo_id=asset["repo_id"], + filename=asset["filename"].format(split=split), + repo_type="dataset", + revision=asset["revision"], + ) + + +def load_benchmark_model(asset: Mapping[str, Any], *, auto_model_cls): + """Load model weights and remote code from the same immutable commit.""" + revision = asset["revision"] + return auto_model_cls.from_pretrained( + asset["repo_id"], + trust_remote_code=True, + revision=revision, + code_revision=revision, + ) + + +def load_benchmark_tokenizer(asset: Mapping[str, Any], *, auto_tokenizer_cls): + """Load the tokenizer from its immutable manifest commit.""" + return auto_tokenizer_cls.from_pretrained( + asset["repo_id"], + revision=asset["revision"], + ) diff --git a/src/speedrunning_plms/flex/__init__.py b/src/speedrunning_plms/flex/__init__.py new file mode 100644 index 000000000..4a149a48e --- /dev/null +++ b/src/speedrunning_plms/flex/__init__.py @@ -0,0 +1,11 @@ +from speedrunning_plms.flex.mods import ( + create_score_mod, + generate_dilated_sliding_window, + visualize_attention_scores, +) + +__all__ = [ + "create_score_mod", + "generate_dilated_sliding_window", + "visualize_attention_scores", +] diff --git a/src/speedrunning_plms/flex/mods.py b/src/speedrunning_plms/flex/mods.py new file mode 100644 index 000000000..6c2603475 --- /dev/null +++ b/src/speedrunning_plms/flex/mods.py @@ -0,0 +1,221 @@ +# https://github.com/pytorch-labs/attention-gym/blob/main/attn_gym/mods/softcapping.py + +import math +import numpy as np +import torch +from typing import Optional +from pathlib import Path +from torch.nn.attention.flex_attention import ( + _score_mod_signature, + _mask_mod_signature, + _vmap_for_bhqkv, + _ModificationType, +) + +try: + from torch._dynamo._trace_wrapped_higher_order_op import TransformGetItemToIndex +except ImportError: + from torch._higher_order_ops.flex_attention import TransformGetItemToIndex +from contextlib import nullcontext + + +def create_score_mod( + query: torch.Tensor, + key: torch.Tensor, + score_mod: Optional[_score_mod_signature], + mask_mod: Optional[_mask_mod_signature], + device: str = "cuda", + _compile: bool = False, + scale: Optional[float] = None, + batch_idx: int = 0, + head_idx: int = 0, +) -> torch.Tensor: + B = 1 + H = 1 + M = query.shape[0] + N = key.shape[0] + + b = torch.arange(0, B, device=device) + batch_idx + h = torch.arange(0, H, device=device) + head_idx + m = torch.arange(0, M, device=device) + n = torch.arange(0, N, device=device) + + scale_factor = 1 / math.sqrt(query.size(-1)) if scale is None else scale + type = _ModificationType.SCORE_MOD if score_mod is not None else _ModificationType.MASK_MOD + if _compile: + ctx = nullcontext() + else: + ctx = TransformGetItemToIndex() + + with ctx: + mod_fn = score_mod if type == _ModificationType.SCORE_MOD else mask_mod + prefix = (0,) if type == _ModificationType.SCORE_MOD else () + mod = _vmap_for_bhqkv(mod_fn, prefix=prefix) + scores = query @ key.transpose(-2, -1) + scores *= scale_factor + scores = scores.view(1, 1, M, N) + if type == _ModificationType.SCORE_MOD: + out = mod(scores, b, h, m, n) + else: + out = mod(b, h, m, n) + + return out + + +def generate_dilated_sliding_window(window_size: int, dilation: int) -> _mask_mod_signature: + """Generates a dilated sliding window attention mask. + Args: + window_size: The size of the sliding window. + dilation: The dilation factor for the sliding window. + + Note: + Query at position i can only attend to keys within a window of size `window_size` + centered around i, where the keys are at positions j such that: + * abs(i - j) <= window_size + * abs(i - j) % dilation == 0 + """ + + def dilated_sliding_window(b, h, q_idx, kv_idx): + diff = torch.abs(q_idx - kv_idx) + in_window = diff <= window_size + is_dilated = (diff % dilation) == 0 + return in_window & is_dilated + + dilated_sliding_window.__name__ = f"dilated_sliding_window_{window_size}_dilation_{dilation}" + return dilated_sliding_window + + +def _name_to_title(name: str) -> str: + title = name.replace("_", " ") + title = " ".join(word.capitalize() for word in title.split()) + return title + + +def visualize_attention_scores( + query: torch.Tensor, + key: torch.Tensor, + score_mod: Optional[_score_mod_signature] = None, + mask_mod: Optional[_mask_mod_signature] = None, + device: str = "cuda", + name: str = "attention_scores", + path: Optional[Path] = None, + batch_idx: int = 0, + head_idx: int = 0, + scale: Optional[float] = None, +): + """ + Generate and save a visualization of attention scores. + + Args: + query (Tensor): Query tensor of shape (batch_size, num_heads, seq_len_q, head_dim). + key (Tensor): Key tensor of shape (batch_size, num_heads, seq_len_k, head_dim). + score_mod (Optional[Callable]): If this is set this will take precedence over the mask_mod. + mask_mod (Optional[Callable]): The mask_mod function used to create block_mask + device (str): Device to run computations on (default: "cuda"). + name (str): Base name for the file and title (default: 'attention_scores'). + path (Path): Path to save the visualization. If None, will be saved to the current working directory. + batch_idx (int): Index of the batch to visualize (default: 0). + head_idx (int): Index of the head to visualize (default: 0). + scale (float): Scale factor to apply to the attention scores. If None, will be set to 1 / sqrt(head_dim). + + Returns: + None + """ + import matplotlib.pyplot as plt + + assert score_mod is not None or mask_mod is not None, ( + "Must provide either score_mod or mask_mod" + ) + query = query[batch_idx, head_idx, :, :] + key = key[batch_idx, head_idx, :, :] + scores_viz = create_score_mod( + query, + key, + score_mod=score_mod, + mask_mod=mask_mod, + scale=scale, + device=device, + batch_idx=batch_idx, + head_idx=head_idx, + ) + # If both score_mod and mask_mod are provided, apply both + if score_mod is not None and mask_mod is not None: + mask_viz = create_score_mod( + query, + key, + score_mod=None, + mask_mod=mask_mod, + scale=scale, + device=device, + batch_idx=batch_idx, + head_idx=head_idx, + ) + # Apply mask by setting masked positions to -inf + scores_viz = torch.where(mask_viz == 0, float("-inf"), scores_viz) + + suffix_title = f"Batch {batch_idx}, Head {head_idx}" if batch_idx != 0 or head_idx != 0 else "" + + fig, ax = plt.subplots(figsize=(12, 10)) + color = "viridis" if score_mod is not None else "cividis" + if score_mod is not None and mask_mod is not None: + color = "plasma" + im = ax.imshow(scores_viz.cpu().detach()[0, 0, :, :], aspect="auto", cmap=color) + fig.colorbar(im) + + title = _name_to_title(name) + file_path = Path(name).with_suffix(".png") if path is None else path.with_suffix(".png") + ax.set_title(f"{title}\n{suffix_title}", fontsize=20) + + ax.set_xlabel("Key Tokens", fontsize=18) + ax.set_ylabel("Query Tokens", fontsize=18) + + # Move y-axis ticks and labels to the top + ax.tick_params(axis="x", top=True, labeltop=True, bottom=False, labelbottom=False) + + # Add tick labels if the number of tokens is manageable + num_query_tokens, num_kv_tokens = scores_viz.shape[-2:] + if num_query_tokens <= 32 and num_kv_tokens <= 32: + ax.set_xticks(range(num_kv_tokens)) + rotation = 45 if num_kv_tokens > 12 else 0 + ax.set_xticklabels( + [f"KV{i}" for i in range(num_kv_tokens)], fontsize=16, rotation=rotation + ) + ax.set_yticks(range(num_query_tokens)) + ax.set_yticklabels([f"Q{i}" for i in range(num_query_tokens)], fontsize=16) + # Align grid with pixel boundaries + ax.set_xticks(np.arange(-0.5, num_kv_tokens, 1), minor=True) + ax.set_yticks(np.arange(-0.5, num_query_tokens, 1), minor=True) + ax.grid(which="minor", color="black", linestyle="-", linewidth=2) + + plt.tight_layout() + plt.savefig(file_path, dpi=300, bbox_inches="tight") + plt.close(fig) # Close the figure to free up memory + + print(f"Visualization saved as {file_path}") + + +def main(device: str = "cpu"): + """Visualize the attention scores of dilated sliding window mask mod. + + Args: + device (str): Device to use for computation. + """ + B, H, SEQ_LEN, HEAD_DIM = 1, 1, 24, 8 + + def make_tensor(): + return torch.ones(B, H, SEQ_LEN, HEAD_DIM, device=device) + + query, key = make_tensor(), make_tensor() + + dilated_sliding_window_mask = generate_dilated_sliding_window(window_size=8, dilation=4) + visualize_attention_scores( + query, + key, + mask_mod=dilated_sliding_window_mask, + device=device, + name="dilated_sliding_window_mask", + ) + + +if __name__ == "__main__": + main() \ No newline at end of file diff --git a/src/speedrunning_plms/models/__init__.py b/src/speedrunning_plms/models/__init__.py new file mode 100644 index 000000000..bea20de41 --- /dev/null +++ b/src/speedrunning_plms/models/__init__.py @@ -0,0 +1,44 @@ +from speedrunning_plms.models.attention import Rotary, SelfAttention +from speedrunning_plms.models.layers import BottleneckMLP, Linear, MLP, correction_fn, norm +from speedrunning_plms.models.plm import ( + BatchedTransformerBlock, + BatchedUnetTransformer, + BatchedValueEmbedding, + ESMOutput, + LMHead, + PLM, + PLMConfig, + PatchExpand, + PatchMerge, + Transformer, + TransformerBlock, + UnetTransformer, + ValueEmbedding, + get_hidden_sizes, + precompute_multiresolution_masks, +) + +__all__ = [ + "BatchedTransformerBlock", + "BatchedUnetTransformer", + "BatchedValueEmbedding", + "BottleneckMLP", + "ESMOutput", + "LMHead", + "Linear", + "MLP", + "PLM", + "PLMConfig", + "PatchExpand", + "PatchMerge", + "Rotary", + "SelfAttention", + "Transformer", + "TransformerBlock", + "UnetTransformer", + "ValueEmbedding", + "correction_fn", + "get_hidden_sizes", + "norm", + "precompute_multiresolution_masks", +] diff --git a/src/speedrunning_plms/models/architectures.py b/src/speedrunning_plms/models/architectures.py new file mode 100644 index 000000000..e262a6eac --- /dev/null +++ b/src/speedrunning_plms/models/architectures.py @@ -0,0 +1,27 @@ +from speedrunning_plms.models.plm import ( + BatchedTransformerBlock, + BatchedUnetTransformer, + BatchedValueEmbedding, + LMHead, + PatchExpand, + PatchMerge, + Transformer, + TransformerBlock, + UnetTransformer, + ValueEmbedding, + get_hidden_sizes, +) + +__all__ = [ + "BatchedTransformerBlock", + "BatchedUnetTransformer", + "BatchedValueEmbedding", + "LMHead", + "PatchExpand", + "PatchMerge", + "Transformer", + "TransformerBlock", + "UnetTransformer", + "ValueEmbedding", + "get_hidden_sizes", +] diff --git a/src/speedrunning_plms/models/attention.py b/src/speedrunning_plms/models/attention.py new file mode 100644 index 000000000..3480e4f35 --- /dev/null +++ b/src/speedrunning_plms/models/attention.py @@ -0,0 +1,124 @@ +import torch +import torch.nn as nn +import torch.nn.functional as F +import math +from typing import Optional +from torch.nn.attention.flex_attention import create_mask, flex_attention + +from .layers import Linear, norm + + +class Rotary(nn.Module): + def __init__(self, dim, base=10000): + super().__init__() + self.register_buffer('inv_freq', (1 / base) ** (torch.arange(0, dim, 2) / dim)) + self.seq_len_cached = None + self.cos_cached = None + self.sin_cached = None + + def forward(self, x: torch.Tensor) -> torch.Tensor: + seq_len = x.shape[1] + if seq_len != self.seq_len_cached: + t = torch.arange(seq_len, device=x.device) + freqs = torch.outer(t, self.inv_freq) + self.seq_len_cached = seq_len + self.cos_cached = freqs.cos() + self.sin_cached = freqs.sin() + cos, sin = self.cos_cached[None, :, None, :], self.sin_cached[None, :, None, :] + # apply_rotary_emb(x, cos, sin) + x1, x2 = x.chunk(2, dim=3) + y1 = x1 * cos + x2 * sin + y2 = x1 * (-sin) + x2 * cos + return torch.cat((y1, y2), 3).type_as(x) + + +class SelfAttention(nn.Module): + def __init__(self, config): + super().__init__() + self.config = config + self.hidden_size = config.hidden_size + self.n_heads = config.num_attention_heads + self.d_head = self.hidden_size // self.n_heads + + assert self.hidden_size % self.n_heads == 0 + self.Wq = Linear(self.hidden_size, self.hidden_size) + self.Wk = Linear(self.hidden_size, self.hidden_size) + self.Wv = Linear(self.hidden_size, self.hidden_size) + self.rotary = Rotary(self.d_head) # dim // num_attention_heads = head_dim + self.Wo = Linear(self.hidden_size, self.hidden_size) + self.Wo.weight.data.zero_() # zero init suggested by @Grad6230497 + + if config.unet: + self.lambdas = nn.Parameter(torch.tensor([0.5, 0.5])) + + self.unet = config.unet + self.flex_attention = flex_attention + if config.compile_flex_attention: + self.flex_attention = torch.compile(flex_attention) + + def forward( + self, + x: torch.Tensor, + attention_mask: Optional[torch.Tensor] = None, + vi: Optional[torch.Tensor] = None, + **kwargs, + ) -> torch.Tensor: + # Support both (L, D) legacy format and (B, L, D) batched format + squeeze_out = False + if x.dim() == 2: + x = x.unsqueeze(0) # (L, D) -> (1, L, D) + squeeze_out = True + if vi is not None: + vi = vi.unsqueeze(0) + + B, l, d = x.size() + q, k, v = self.Wq(x), self.Wk(x), self.Wv(x) + + q = q.view(B, l, self.n_heads, self.d_head) + k = k.view(B, l, self.n_heads, self.d_head) + v = v.view(B, l, self.n_heads, self.d_head) + + if self.unet and vi is not None: + v = self.lambdas[0] * v + self.lambdas[1] * vi.view_as(v) + + q, k = norm(q), norm(k) + q, k = self.rotary(q), self.rotary(k) + if attention_mask is None: + assert l <= 1, "attention_mask is required for seq_len > 1 to avoid dense attention" + + q, k, v = q.transpose(1, 2), k.transpose(1, 2), v.transpose(1, 2) + if q.device.type == "cpu": + # FlexAttention does not support CPU backward. Build the exact + # token-level mask from the BlockMask closure and use PyTorch's + # differentiable dense attention fallback for CPU use. + dense_mask = None + if attention_mask is not None: + dense_mask = create_mask( + attention_mask.mask_mod, + B=B, + H=self.n_heads, + Q_LEN=l, + KV_LEN=l, + device=q.device, + ) + y = F.scaled_dot_product_attention( + q, + k, + v, + attn_mask=dense_mask, + ) + else: + y = self.flex_attention( + q, + k, + v, + score_mod=None, + block_mask=attention_mask, + enable_gqa=True, + ) + y = y.transpose(1, 2).contiguous().view(B, l, d) + y = self.Wo(y) + + if squeeze_out: + y = y.squeeze(0) + return y diff --git a/src/speedrunning_plms/models/config.py b/src/speedrunning_plms/models/config.py new file mode 100644 index 000000000..e0efafc01 --- /dev/null +++ b/src/speedrunning_plms/models/config.py @@ -0,0 +1,3 @@ +from speedrunning_plms.models.plm import ESMOutput, PLMConfig + +__all__ = ["ESMOutput", "PLMConfig"] diff --git a/src/speedrunning_plms/models/layers.py b/src/speedrunning_plms/models/layers.py new file mode 100644 index 000000000..70e9b73ba --- /dev/null +++ b/src/speedrunning_plms/models/layers.py @@ -0,0 +1,68 @@ +import torch +import torch.nn as nn +import torch.nn.functional as F + + +def norm(x: torch.Tensor) -> torch.Tensor: + return F.rms_norm(x, (x.size(-1),)) + + +class Linear(nn.Linear): + def __init__(self, in_features, out_features): + super().__init__(in_features, out_features, bias=False) + + def forward(self, x: torch.Tensor) -> torch.Tensor: + return F.linear(x, self.weight.to(x.dtype)) + + +def correction_fn(expansion_ratio: float, d_model: int) -> int: + return int(((expansion_ratio * d_model) + 255) // 256 * 256) + + +class MLP(nn.Module): + def __init__(self, config): + super().__init__() + corrected_dim = correction_fn(config.expansion_ratio, config.hidden_size) + self.up = Linear(config.hidden_size, corrected_dim) + self.down = Linear(corrected_dim, config.hidden_size) + self.down.weight.data.zero_() + self.relu = nn.ReLU() + + def forward(self, x: torch.Tensor) -> torch.Tensor: + return self.down(self.relu(self.up(x)).square()) + + +class BottleneckMLP(nn.Module): + """MLP block used when sequence is a vector (length 1) in Conv1D UNet. + Replaces transformer blocks at depths where sequence length = 1. + Takes hidden_size directly instead of config to support variable sizes per layer. + """ + def __init__(self, hidden_size: int, expansion_ratio: float, base_hidden_size: int = None): + super().__init__() + corrected_dim = correction_fn(expansion_ratio, hidden_size) + self.up = Linear(hidden_size, corrected_dim) + self.down = Linear(corrected_dim, hidden_size) + self.down.weight.data.zero_() + self.relu = nn.ReLU() + self.lambdas = nn.Parameter(torch.tensor([1., 0.])) + + # Projection layer for x0 if hidden sizes differ (for Conv1D UNet) + if base_hidden_size is not None and base_hidden_size != hidden_size: + self.x0_projection = Linear(base_hidden_size, hidden_size) + else: + self.x0_projection = None + + def forward( + self, + x: torch.Tensor, + x0: torch.Tensor = None, + **kwargs, + ) -> torch.Tensor: + # Apply residual mixing with x0 if provided (for UNet skip connections) + if x0 is not None: + if self.x0_projection is not None: + x0 = self.x0_projection(x0) + x = self.lambdas[0] * x + self.lambdas[1] * x0 + # Two-layer MLP with squared ReLU + out = self.down(self.relu(self.up(norm(x))).square()) + return x + out diff --git a/src/speedrunning_plms/models/masks.py b/src/speedrunning_plms/models/masks.py new file mode 100644 index 000000000..161635c7f --- /dev/null +++ b/src/speedrunning_plms/models/masks.py @@ -0,0 +1,3 @@ +from speedrunning_plms.models.plm import precompute_multiresolution_masks + +__all__ = ["precompute_multiresolution_masks"] diff --git a/src/speedrunning_plms/models/plm.py b/src/speedrunning_plms/models/plm.py new file mode 100644 index 000000000..3af4b2308 --- /dev/null +++ b/src/speedrunning_plms/models/plm.py @@ -0,0 +1,1220 @@ +import math +import torch +import torch.nn as nn +import torch.nn.functional as F +from typing import Optional, List +from dataclasses import dataclass +from torch.nn.attention.flex_attention import create_block_mask +from transformers import EsmTokenizer, PretrainedConfig, PreTrainedModel +from transformers.modeling_outputs import MaskedLMOutput + +from .attention import SelfAttention +from .layers import BottleneckMLP, Linear, MLP, correction_fn, norm + + +REMOTE_CODE_AUTO_MAP = { + "AutoConfig": "plm.PLMConfig", + "AutoModelForMaskedLM": "plm.PLM", +} + + +@dataclass +class PLMConfig(PretrainedConfig): + model_type = "speedrunning_plm" + + def __init__( + self, + hidden_size: int = 512, + num_attention_heads: int = 8, + num_hidden_layers: int = 12, + num_unet_layers: int = 0, + num_extra_layers: int = 0, + max_sequence_length: int = 1024, + vocab_size: int = 33, + expansion_ratio: float = 2.0, + soft_logit_cap: float = 16.0, + sliding_window_size: int = 2048, + tie_embeddings: Optional[bool] = None, + unet: bool = False, + patch_unet: bool = False, + mlm: bool = False, + masked_diffusion: bool = False, + token_dropout: bool = True, + compile_flex_attention: bool = True, + tokenizer_name: Optional[str] = "facebook/esm2_t6_8M_UR50D", + cls_token_id: Optional[int] = None, + eos_token_id: Optional[int] = None, + pad_token_id: Optional[int] = None, + mask_token_id: Optional[int] = None, + **kwargs, + ): + standard_tie_embeddings = kwargs.pop("tie_word_embeddings", None) + if tie_embeddings is None: + tie_embeddings = ( + bool(standard_tie_embeddings) + if standard_tie_embeddings is not None + else False + ) + super().__init__(tie_word_embeddings=bool(tie_embeddings), **kwargs) + self.hidden_size = hidden_size + self.num_attention_heads = num_attention_heads + self.num_hidden_layers = num_hidden_layers + self.num_unet_layers = num_unet_layers + self.num_extra_layers = num_extra_layers + self.max_sequence_length = max_sequence_length + self.vocab_size = vocab_size + self.expansion_ratio = expansion_ratio + self.soft_logit_cap = soft_logit_cap + self.sliding_window_size = sliding_window_size + self.tie_embeddings = bool(tie_embeddings) + self.unet = unet + self.patch_unet = patch_unet + self.mlm = mlm + self.masked_diffusion = masked_diffusion + self.token_dropout = token_dropout + self.compile_flex_attention = compile_flex_attention + self.tokenizer_name = tokenizer_name + self.cls_token_id = cls_token_id + self.eos_token_id = eos_token_id + self.pad_token_id = pad_token_id + self.mask_token_id = mask_token_id + # Keep the checkpoint self-contained for AutoClass loading with + # trust_remote_code=True. Transformers expects module.Class, not + # repo--Class, for code stored in the same model repository. + existing_auto_map = dict(getattr(self, "auto_map", {})) + existing_auto_map.pop("AutoModel", None) + self.auto_map = {**existing_auto_map, **REMOTE_CODE_AUTO_MAP} + + +# Backwards-compatible public alias. PLM.forward now returns the standard +# Transformers masked-language-model output type. +ESMOutput = MaskedLMOutput + + +def get_hidden_sizes(hidden_size: int, num_encoder_layers: int, num_attention_heads: int = 1, max_head_dim: int = 128) -> List[int]: + """Returns hidden size for each encoder layer, rounded to multiples of 64 and num_attention_heads. + Scales from hidden_size toward hidden_size * 2 at the bottleneck, capped so that + head_dim (hidden / num_heads) never exceeds max_head_dim. + + This cap prevents Triton shared memory overflow in flex_attention kernels. + For more hidden dimension growth, increase num_attention_heads (Swin Transformer style). + + Args: + hidden_size: Base hidden size + num_encoder_layers: Number of encoder layers + num_attention_heads: Number of attention heads (hidden size must be divisible by this) + max_head_dim: Maximum per-head dimension (default 128, safe for Triton SRAM) + """ + from math import gcd + # Find LCM of 64 and num_attention_heads for GPU efficiency and head divisibility + alignment = (64 * num_attention_heads) // gcd(64, num_attention_heads) + # Maximum hidden size enforced by head_dim constraint + max_hidden = num_attention_heads * max_head_dim + # Round max_hidden down to alignment + max_hidden = (max_hidden // alignment) * alignment + + sizes = [] + for i in range(num_encoder_layers): + # Linear interpolation from 1.0 to 2.0 + scale = 1.0 + (i / max(num_encoder_layers - 1, 1)) + raw_size = hidden_size * scale + # Round up to nearest alignment + rounded = int(((raw_size + alignment - 1) // alignment) * alignment) + # Clamp to max_hidden to prevent head_dim overflow + rounded = min(rounded, max_hidden) + sizes.append(rounded) + return sizes + + +class PatchMerge(nn.Module): + """Downsample sequence by 2x via Swin-style patch merging. + Concatenates adjacent token pairs and projects to new dimension. + (B, L, D_in) -> (B, L//2, D_out) + """ + def __init__(self, in_dim: int, out_dim: int): + super().__init__() + self.projection = Linear(2 * in_dim, out_dim) + + def forward(self, x: torch.Tensor) -> torch.Tensor: + B, L, D = x.shape + assert L % 2 == 0, f"Sequence length {L} must be even for PatchMerge" + x = x.view(B, L // 2, 2 * D) + return self.projection(x) + + +class PatchExpand(nn.Module): + """Upsample sequence by 2x via linear projection and reshape. + (B, L//2, D_in) -> (B, L, D_out) + """ + def __init__(self, in_dim: int, out_dim: int): + super().__init__() + self.projection = Linear(in_dim, 2 * out_dim) + self.out_dim = out_dim + + def forward(self, x: torch.Tensor) -> torch.Tensor: + B, L_half, D = x.shape + x = self.projection(x) # (B, L_half, 2 * out_dim) + return x.view(B, L_half * 2, self.out_dim) + + +class ValueEmbedding(nn.Module): + def __init__(self, config: PLMConfig): + super().__init__() + self.embed = nn.ModuleList([ + nn.Embedding(config.vocab_size, config.hidden_size) + for _ in range(config.num_hidden_layers // 2) + ]) + + def forward(self, inputs: torch.Tensor) -> List[torch.Tensor]: + ve = [emb(inputs) for emb in self.embed] + ve += reversed(ve) + return ve + + +class LMHead(nn.Module): + def __init__(self, hidden_size: int, vocab_size: int, soft_logit_cap: float = 30.0): + super().__init__() + self.dense = Linear(hidden_size, hidden_size) + self.decoder = Linear(hidden_size, vocab_size) + self.bias = nn.Parameter(torch.zeros(vocab_size)) + self.soft_logit_cap = soft_logit_cap + self.act = nn.GELU() + + def forward(self, x: torch.Tensor) -> torch.Tensor: + x = self.dense(norm(x)) + x = self.act(x) + x = self.decoder(x) + self.bias + return self.soft_logit_cap * torch.tanh(x / self.soft_logit_cap) + + +class TransformerBlock(nn.Module): + def __init__(self, config: PLMConfig): + super().__init__() + self.config = config + self.attn = SelfAttention(config) + self.mlp = MLP(config) + self.unet = config.unet + if config.unet: + self.lambdas = nn.Parameter(torch.tensor([1., 0.])) + + def forward( + self, + x: torch.Tensor, + attention_mask: Optional[torch.Tensor] = None, + vi: Optional[torch.Tensor] = None, + x0: Optional[torch.Tensor] = None, + last_eos: Optional[int] = None, + **kwargs, + ) -> torch.Tensor: + if self.unet: + x = self.lambdas[0] * x + self.lambdas[1] * x0 + x = x + self.attn( + x=norm(x), + attention_mask=attention_mask, + vi=vi, + last_eos=last_eos, + **kwargs, + ) + else: + x = x + self.attn( + x=norm(x), + attention_mask=attention_mask, + last_eos=last_eos, + **kwargs, + ) + x = x + self.mlp(norm(x)) + return x + + +class Transformer(nn.Module): + def __init__(self, config: PLMConfig): + super().__init__() + self.layers = nn.ModuleList([TransformerBlock(config) for _ in range(config.num_hidden_layers)]) + + def forward( + self, + x: torch.Tensor, + attention_mask: Optional[torch.Tensor] = None, + **kwargs, + ) -> torch.Tensor: + for layer in self.layers: + x = layer( + x=x, + attention_mask=attention_mask, + **kwargs, + ) + return x + + +class UnetTransformer(nn.Module): + def __init__(self, config: PLMConfig): + super().__init__() + assert config.num_hidden_layers % 2 == 0 + self.num_encoder_layers = config.num_hidden_layers // 2 + self.num_decoder_layers = config.num_hidden_layers // 2 + + self.skip_weights = nn.Parameter(torch.ones(self.num_decoder_layers)) + + self.layers = nn.ModuleList([TransformerBlock(config) for _ in range(config.num_hidden_layers)]) + + def forward( + self, + x: torch.Tensor, + ve: List[torch.Tensor], + attention_mask: Optional[torch.Tensor] = None, + **kwargs, + ) -> torch.Tensor: + x0 = x + ve_enc, ve_dec = ve[:self.num_encoder_layers], ve[self.num_encoder_layers:] + skip_connections = [] + for i in range(self.num_encoder_layers): + x = self.layers[i]( + x=x, + attention_mask=attention_mask, + vi=ve_enc[i], + x0=x0, + **kwargs, + ) + skip_connections.append(x) + + for i in range(self.num_decoder_layers): + x = x + self.skip_weights[i] * skip_connections.pop() + x = self.layers[self.num_encoder_layers + i]( + x=x, + attention_mask=attention_mask, + vi=ve_dec[i], + x0=x0, + **kwargs, + ) + return x + + +class BatchedTransformerBlock(nn.Module): + """TransformerBlock for batched (B, L, D) input with variable hidden sizes per layer. + Supports x0 lambda mixing and value embedding mixing in attention. + """ + def __init__( + self, + hidden_size: int, + num_attention_heads: int, + expansion_ratio: float, + base_hidden_size: int = None, + compile_flex_attention: bool = True, + ): + super().__init__() + from types import SimpleNamespace + config = SimpleNamespace( + hidden_size=hidden_size, + num_attention_heads=num_attention_heads, + unet=True, + compile_flex_attention=compile_flex_attention, + ) + self.attn = SelfAttention(config) + + corrected_dim = correction_fn(expansion_ratio, hidden_size) + self.mlp_up = Linear(hidden_size, corrected_dim) + self.mlp_down = Linear(corrected_dim, hidden_size) + self.mlp_down.weight.data.zero_() + self.mlp_relu = nn.ReLU() + + self.lambdas = nn.Parameter(torch.tensor([1., 0.])) + + if base_hidden_size is not None and base_hidden_size != hidden_size: + self.x0_projection = Linear(base_hidden_size, hidden_size) + else: + self.x0_projection = None + + def forward( + self, + x: torch.Tensor, + attention_mask: Optional[torch.Tensor] = None, + vi: Optional[torch.Tensor] = None, + x0: Optional[torch.Tensor] = None, + **kwargs, + ) -> torch.Tensor: + if x0 is not None: + if self.x0_projection is not None: + x0 = self.x0_projection(x0) + x = self.lambdas[0] * x + self.lambdas[1] * x0 + + x = x + self.attn(x=norm(x), attention_mask=attention_mask, vi=vi, **kwargs) + mlp_out = self.mlp_down(self.mlp_relu(self.mlp_up(norm(x))).square()) + x = x + mlp_out + return x + + +class BatchedValueEmbedding(nn.Module): + """Value embeddings for batched UNet with variable hidden sizes per layer. + Embeddings are computed at full resolution from input_ids (B, L). + Spatial downsampling to match each layer's resolution is handled by the transformer. + """ + def __init__(self, vocab_size: int, hidden_sizes: List[int]): + super().__init__() + num_encoder_layers = len(hidden_sizes) + self.encoder_embed = nn.ModuleList([ + nn.Embedding(vocab_size, hidden_sizes[i]) + for i in range(num_encoder_layers) + ]) + self.decoder_embed = nn.ModuleList([ + nn.Embedding(vocab_size, hidden_sizes[num_encoder_layers - 1 - i]) + for i in range(num_encoder_layers) + ]) + + def forward(self, input_ids: torch.Tensor) -> tuple: + """ + input_ids: (B, L) + Returns (encoder_ve, decoder_ve) lists of value embeddings at full resolution. + encoder_ve[i] has shape (B, L, hidden_sizes[i]). + """ + encoder_ve = [emb(input_ids) for emb in self.encoder_embed] + decoder_ve = [emb(input_ids) for emb in self.decoder_embed] + return encoder_ve, decoder_ve + + +@torch.compiler.disable +def precompute_multiresolution_masks( + input_ids: torch.Tensor, + cls_token_id: int, + pad_token_id: int, + num_levels: int, + sliding_window_size: int, + n_heads: int, + device: torch.device, + attention_mask: Optional[torch.Tensor] = None, +) -> List[Optional[object]]: + """Pre-compute flex attention block masks at each UNet resolution level. + + This function is excluded from torch.compile via @torch.compiler.disable because + create_block_mask is designed to run outside compiled regions, and tensors captured + by mask_mod closures must be real (eager) tensors -- not Inductor ComputedBuffers + with FlexibleLayout, which cause LoweringException in flex_attention_backward. + + Args: + input_ids: (B, L) token IDs + cls_token_id: CLS/BOS token ID marking document starts + pad_token_id: PAD token ID + num_levels: Number of resolution levels (including full resolution) + sliding_window_size: Sliding window size for attention + n_heads: Number of attention heads + device: Device for mask computation + attention_mask: Optional (B, L) mask where nonzero tokens are valid. + + Returns: + List of BlockMask objects, one per resolution level. None for levels where L<=1. + """ + B, L = input_ids.shape + + # Compute document IDs from CLS token positions (CLS marks start of each document) + doc_ids = (input_ids == cls_token_id).cumsum(dim=1) # (B, L) + + if attention_mask is None: + valid_tokens = input_ids != pad_token_id + else: + if attention_mask.shape != input_ids.shape: + raise ValueError( + "attention_mask must have the same shape as input_ids; " + f"got {attention_mask.shape} and {input_ids.shape}." + ) + valid_tokens = attention_mask.to(device=device, dtype=torch.bool) + + masks = [] + current_doc_ids = doc_ids + current_valid_tokens = valid_tokens + current_L = L + + for level in range(num_levels): + if current_L <= 1: + masks.append(None) + continue + + # Capture loop variables in closure via default args + def make_mask_mod(doc_ids_l, valid_tokens_l, sw_l): + def mask_mod(b, h, q_idx, kv_idx): + doc_mask = doc_ids_l[b, q_idx] == doc_ids_l[b, kv_idx] + sw_mask = torch.abs(q_idx - kv_idx) < sw_l + pad_mask = valid_tokens_l[b, q_idx] & valid_tokens_l[b, kv_idx] + return doc_mask & sw_mask & pad_mask + return mask_mod + + mask_mod = make_mask_mod(current_doc_ids, current_valid_tokens, sliding_window_size) + + block_mask = create_block_mask( + mask_mod=mask_mod, + B=B, + H=n_heads, + Q_LEN=current_L, + KV_LEN=current_L, + device=device, + ) + masks.append(block_mask) + + # A merged token remains valid if either source token is valid. + if current_L > 1: + current_doc_ids = current_doc_ids.view(B, current_L // 2, 2).max(dim=-1).values + current_valid_tokens = current_valid_tokens.view(B, current_L // 2, 2).any(dim=-1) + current_L = current_L // 2 + + return masks + + +class BatchedUnetTransformer(nn.Module): + """Batched UNet Transformer with Swin-style patch merging/expanding. + + Operates on (B, L, D) tensors with pre-computed multi-resolution block masks. + Uses PatchMerge for downsampling and PatchExpand for upsampling. + Skip connections link encoder and decoder at matching resolutions. + + Architecture: + - Encoder: TransformerBlock -> PatchMerge -> TransformerBlock -> PatchMerge -> ... + - BottleneckMLP at vector depth (when L=1) + - Decoder: PatchExpand -> TransformerBlock + skip -> PatchExpand -> ... + """ + def __init__(self, config: PLMConfig): + super().__init__() + assert config.num_unet_layers % 2 == 0, "num_unet_layers must be even" + assert config.max_sequence_length > 0 and (config.max_sequence_length & (config.max_sequence_length - 1)) == 0, \ + f"max_sequence_length must be a power of 2 for PatchMerge, got {config.max_sequence_length}" + + self.num_encoder_layers = config.num_unet_layers // 2 + self.num_decoder_layers = config.num_unet_layers // 2 + self.base_hidden_size = config.hidden_size + self.max_sequence_length = config.max_sequence_length + + # Vector depth: after this many downsamplings, seq_len=1 + self.vector_depth = int(math.log2(config.max_sequence_length)) + + # Hidden sizes for each encoder layer depth + self.hidden_sizes = get_hidden_sizes(config.hidden_size, self.num_encoder_layers, config.num_attention_heads) + + # Number of resolution levels (for mask pre-computation) + self.num_resolution_levels = min(self.num_encoder_layers, self.vector_depth + 1) + + # Encoder blocks + self.encoder_blocks = nn.ModuleList() + self.downsamples = nn.ModuleList() + + for i in range(self.num_encoder_layers): + layer_hidden_size = self.hidden_sizes[min(i, self.vector_depth)] + + if i >= self.vector_depth: + self.encoder_blocks.append( + BottleneckMLP(layer_hidden_size, config.expansion_ratio, self.base_hidden_size) + ) + else: + self.encoder_blocks.append( + BatchedTransformerBlock( + hidden_size=layer_hidden_size, + num_attention_heads=config.num_attention_heads, + expansion_ratio=config.expansion_ratio, + base_hidden_size=self.base_hidden_size, + compile_flex_attention=config.compile_flex_attention, + ) + ) + + # PatchMerge between layers (not after last encoder, not past vector depth) + if i < self.num_encoder_layers - 1 and i < self.vector_depth: + next_hidden = self.hidden_sizes[min(i + 1, self.vector_depth)] + self.downsamples.append(PatchMerge(layer_hidden_size, next_hidden)) + + # Decoder blocks + self.decoder_blocks = nn.ModuleList() + self.upsamples = nn.ModuleList() + + for i in range(self.num_decoder_layers): + enc_idx = self.num_encoder_layers - 1 - i + effective_depth = enc_idx + decoder_hidden_size = self.hidden_sizes[min(enc_idx, self.vector_depth)] + + # PatchExpand before each decoder layer (except first/bottleneck) + prev_depth = self.num_encoder_layers - i + if i > 0 and prev_depth <= self.vector_depth: + prev_hidden = self.hidden_sizes[min(prev_depth, self.vector_depth)] + self.upsamples.append(PatchExpand(prev_hidden, decoder_hidden_size)) + + if effective_depth >= self.vector_depth: + self.decoder_blocks.append( + BottleneckMLP(decoder_hidden_size, config.expansion_ratio, self.base_hidden_size) + ) + else: + self.decoder_blocks.append( + BatchedTransformerBlock( + hidden_size=decoder_hidden_size, + num_attention_heads=config.num_attention_heads, + expansion_ratio=config.expansion_ratio, + base_hidden_size=self.base_hidden_size, + compile_flex_attention=config.compile_flex_attention, + ) + ) + + # Skip connection weights + self.skip_weights = nn.Parameter(torch.ones(self.num_decoder_layers)) + + # Input/output projections if base hidden size differs from first layer + if self.hidden_sizes[0] != config.hidden_size: + self.input_projection = Linear(config.hidden_size, self.hidden_sizes[0]) + self.output_projection = Linear(self.hidden_sizes[0], config.hidden_size) + else: + self.input_projection = None + self.output_projection = None + + def _downsample_to_resolution(self, x: torch.Tensor, target_L: int) -> torch.Tensor: + """Average-pool pairs to spatially downsample x to target sequence length.""" + B, L, D = x.shape + while L > target_L: + assert L % 2 == 0, f"Cannot halve sequence length {L}" + x = x.view(B, L // 2, 2, D).mean(dim=2) + L = L // 2 + return x + + def forward( + self, + x: torch.Tensor, + encoder_ve: List[torch.Tensor], + decoder_ve: List[torch.Tensor], + attention_masks: List[Optional[object]], + x0_full: torch.Tensor, + **kwargs, + ) -> torch.Tensor: + """ + Forward pass for batched UNet. + + Args: + x: (B, L, D) input embeddings + encoder_ve: List of value embeddings at full resolution per encoder layer + decoder_ve: List of value embeddings at full resolution per decoder layer + attention_masks: Pre-computed BlockMask per resolution level + x0_full: (B, L, D_base) original input for lambda mixing + """ + # Project input to first layer hidden size if needed + if self.input_projection is not None: + x = self.input_projection(x) + + # Encoder path + skip_connections = [] + mask_idx = 0 + downsample_idx = 0 + current_L = x.shape[1] + + for i in range(self.num_encoder_layers): + # Attention mask for this resolution + attn_mask = attention_masks[mask_idx] if mask_idx < len(attention_masks) else None + + # Downsample value embedding to current resolution + vi = None + if i < len(encoder_ve): + vi = self._downsample_to_resolution(encoder_ve[i], current_L) + + # Downsample x0 to current resolution (x0 stays at base_hidden_size, + # each block's x0_projection handles dim change) + x0_current = self._downsample_to_resolution(x0_full, current_L) + + # Apply block + x = self.encoder_blocks[i]( + x=x, + attention_mask=attn_mask, + vi=vi, + x0=x0_current, + **kwargs, + ) + skip_connections.append(x) + + # Downsample for next layer + if i < self.num_encoder_layers - 1 and i < self.vector_depth: + x = self.downsamples[downsample_idx](x) + downsample_idx += 1 + mask_idx += 1 + current_L = x.shape[1] + + # Decoder path + upsample_idx = 0 + for i in range(self.num_decoder_layers): + skip = skip_connections.pop() + + effective_depth = self.num_encoder_layers - 1 - i + prev_depth = self.num_encoder_layers - i + + # Upsample x to match skip resolution + if i > 0 and prev_depth <= self.vector_depth: + x = self.upsamples[upsample_idx](x) + upsample_idx += 1 + current_L = x.shape[1] + + # Add skip connection + x = x + self.skip_weights[i] * skip + + # Attention mask for decoder at this resolution + dec_mask_idx = min(effective_depth, len(attention_masks) - 1) + attn_mask = attention_masks[dec_mask_idx] if attention_masks else None + + # Downsample value embedding to current resolution + vi = None + if i < len(decoder_ve): + vi = self._downsample_to_resolution(decoder_ve[i], current_L) + + # Downsample x0 to current resolution + x0_current = self._downsample_to_resolution(x0_full, current_L) + + # Apply block + x = self.decoder_blocks[i]( + x=x, + attention_mask=attn_mask, + vi=vi, + x0=x0_current, + **kwargs, + ) + + # Project output back to base hidden size if needed + if self.output_projection is not None: + x = self.output_projection(x) + + return x + + +class PLM(PreTrainedModel): + config_class = PLMConfig + _tied_weights_keys = ["lm_head.decoder.weight"] + + def __init__(self, config: PLMConfig): + super().__init__(config) + self.config = config + explicit_token_ids = ( + config.cls_token_id, + config.eos_token_id, + config.pad_token_id, + config.mask_token_id, + ) + if all(token_id is not None for token_id in explicit_token_ids): + self.tokenizer = None + self.cls_token_id = int(config.cls_token_id) + self.eos_token_id = int(config.eos_token_id) + self.pad_token_id = int(config.pad_token_id) + self.mask_token_id = int(config.mask_token_id) + else: + if config.tokenizer_name is None: + raise ValueError("tokenizer_name is required unless all token IDs are provided in PLMConfig.") + self.tokenizer = EsmTokenizer.from_pretrained(config.tokenizer_name) + self.cls_token_id = self.tokenizer.cls_token_id + self.eos_token_id = self.tokenizer.eos_token_id + self.pad_token_id = self.tokenizer.pad_token_id + self.mask_token_id = self.tokenizer.mask_token_id + # Persist resolved IDs so published checkpoints can reload without + # fetching an external tokenizer merely to construct the model. + self.config.cls_token_id = self.cls_token_id + self.config.eos_token_id = self.eos_token_id + self.config.pad_token_id = self.pad_token_id + self.config.mask_token_id = self.mask_token_id + self.mlm = config.mlm + self.masked_diffusion = config.masked_diffusion + self.token_dropout = config.token_dropout + + self.vocab_size = config.vocab_size + self.n_heads = config.num_attention_heads + self.sliding_window_size = config.sliding_window_size + + self.embedding = nn.Embedding(config.vocab_size, config.hidden_size) + + self.unet = config.unet + self.patch_unet = config.patch_unet + + if config.patch_unet: + # Batched UNet with Swin-style patch merge/expand + assert config.num_unet_layers > 0, "num_unet_layers must be > 0 for patch_unet" + self.transformer = BatchedUnetTransformer(config) + hidden_sizes = self.transformer.hidden_sizes + self.value_embeds = BatchedValueEmbedding(config.vocab_size, hidden_sizes) + elif config.unet: + # Original UNet (skip connections only, no downsampling) + self.transformer = UnetTransformer(config) + self.value_embeds = ValueEmbedding(config) + else: + # Standard transformer + self.transformer = Transformer(config) + + # Extra sequential transformer layers after U-Net (at full resolution) + self.num_extra_layers = config.num_extra_layers + if config.num_extra_layers > 0: + # Create a config for extra layers without unet skip connections + from copy import copy + extra_config = copy(config) + extra_config.unet = False + self.extra_layers = nn.ModuleList([ + TransformerBlock(extra_config) + for _ in range(config.num_extra_layers) + ]) + else: + self.extra_layers = None + + self.lm_head = LMHead(config.hidden_size, config.vocab_size, config.soft_logit_cap) + if config.tie_embeddings: + self.lm_head.decoder.weight = self.embedding.weight + + self.ce = nn.CrossEntropyLoss(ignore_index=-100, reduction='mean') + + def get_input_embeddings(self) -> nn.Embedding: + return self.embedding + + def set_input_embeddings(self, value: nn.Embedding) -> None: + self.embedding = value + + def get_output_embeddings(self) -> Linear: + return self.lm_head.decoder + + def set_output_embeddings(self, value: Linear) -> None: + self.lm_head.decoder = value + + def _validated_attention_mask( + self, + input_ids: torch.Tensor, + attention_mask: Optional[torch.Tensor], + ) -> torch.Tensor: + if attention_mask is None: + return input_ids != self.pad_token_id + if attention_mask.shape != input_ids.shape: + raise ValueError( + "attention_mask must have the same shape as input_ids; " + f"got {attention_mask.shape} and {input_ids.shape}." + ) + return attention_mask.to(device=input_ids.device, dtype=torch.bool) + + def _get_standard_hidden_state( + self, + input_ids: torch.Tensor, + sliding_window_size: int, + attention_mask: Optional[torch.Tensor] = None, + ) -> torch.Tensor: + squeeze_output = input_ids.dim() == 1 + valid_tokens = self._validated_attention_mask(input_ids, attention_mask) + if squeeze_output: + input_ids = input_ids.unsqueeze(0) + valid_tokens = valid_tokens.unsqueeze(0) + + batch_size, seq_len = input_ids.shape + docs = (input_ids == self.cls_token_id).cumsum(dim=1) + + def doc_mask_mod(b, h, q_idx, kv_idx): + sliding_mask = torch.abs(q_idx - kv_idx) < sliding_window_size + doc_mask = docs[b, q_idx] == docs[b, kv_idx] + valid_mask = valid_tokens[b, q_idx] & valid_tokens[b, kv_idx] + return sliding_mask & doc_mask & valid_mask + + block_mask = create_block_mask( + mask_mod=doc_mask_mod, + B=batch_size, + H=self.n_heads, + Q_LEN=seq_len, + KV_LEN=seq_len, + device=input_ids.device, + ) + + x = self.embedding(input_ids) + if self.token_dropout: + masked_tokens = (input_ids == self.mask_token_id) & valid_tokens + x = x.masked_fill(masked_tokens.unsqueeze(-1), 0.0) + real_token_count = valid_tokens.sum(dim=1, keepdim=True).float().clamp(min=1) + mask_count = masked_tokens.sum(dim=1, keepdim=True).float() + mask_ratio_observed = mask_count / real_token_count + x = (x * (1 - mask_ratio_observed.unsqueeze(-1))).to(x.dtype) + + x = norm(x) + if self.unet: + ve = self.value_embeds(input_ids) + x = self.transformer(x=x, ve=ve, attention_mask=block_mask) + else: + x = self.transformer(x=x, attention_mask=block_mask) + + if self.extra_layers is not None: + for layer in self.extra_layers: + x = layer(x=x, attention_mask=block_mask) + return x.squeeze(0) if squeeze_output else x + + def get_last_hidden_state( + self, + input_ids: torch.Tensor, + sliding_window_size: int, + attention_mask: Optional[torch.Tensor] = None, + ) -> torch.Tensor: + """Return hidden states for legacy 1D or standard batched token input.""" + if input_ids.dim() not in (1, 2): + raise ValueError( + "input_ids must have shape (sequence_length,) or " + f"(batch_size, sequence_length); got {input_ids.shape}." + ) + + if self.patch_unet: + if input_ids.dim() != 2: + raise ValueError( + f"patch_unet expects batched (B, L) input, got {input_ids.shape}." + ) + valid_tokens = self._validated_attention_mask(input_ids, attention_mask) + + attention_masks = precompute_multiresolution_masks( + input_ids=input_ids, + cls_token_id=self.cls_token_id, + pad_token_id=self.pad_token_id, + num_levels=self.transformer.num_resolution_levels, + sliding_window_size=sliding_window_size, + n_heads=self.n_heads, + device=input_ids.device, + attention_mask=valid_tokens, + ) + full_res_mask = attention_masks[0] + x = self.embedding(input_ids) + + if self.token_dropout: + masked_tokens = (input_ids == self.mask_token_id) & valid_tokens + x = x.masked_fill(masked_tokens.unsqueeze(-1), 0.0) + real_token_count = valid_tokens.sum(dim=1, keepdim=True).float().clamp(min=1) + mask_count = masked_tokens.sum(dim=1, keepdim=True).float() + mask_ratio_observed = mask_count / real_token_count + x = (x * (1 - mask_ratio_observed.unsqueeze(-1))).to(x.dtype) + + x = norm(x) + encoder_ve, decoder_ve = self.value_embeds(input_ids) + x = self.transformer( + x=x, + encoder_ve=encoder_ve, + decoder_ve=decoder_ve, + attention_masks=attention_masks, + x0_full=x.clone(), + ) + + if self.extra_layers is not None: + for layer in self.extra_layers: + x = layer(x=x, attention_mask=full_res_mask) + return x + + return self._get_standard_hidden_state( + input_ids, + sliding_window_size, + attention_mask, + ) + + def get_vector_embeddings(self, input_ids: torch.Tensor, sliding_window_size: Optional[int] = None) -> torch.Tensor: + """Mean-pool hidden states per document to get per-document embeddings. + + Args: + input_ids: (B, L) for patch_unet or (total_len,) for standard/unet + sliding_window_size: Override sliding window size + + Returns: + For patch_unet (B, L): flattened (total_docs, hidden_size) across all batch elements + For standard (total_len,): (num_docs, hidden_size) + """ + if sliding_window_size is None: + sliding_window_size = self.sliding_window_size + x = self.get_last_hidden_state(input_ids, sliding_window_size) + + if input_ids.dim() == 2: + # Batched: x is (B, L, D), input_ids is (B, L) + B, L, D = x.shape + doc_ids = (input_ids == self.cls_token_id).cumsum(dim=1) # (B, L) + # Flatten batch into single sequence for mean pooling + x_flat = x.reshape(-1, D) # (B*L, D) + # Offset doc_ids per batch element so each batch has unique doc IDs + max_docs_per_batch = doc_ids.max(dim=1).values # (B,) + offsets = torch.zeros(B, dtype=doc_ids.dtype, device=doc_ids.device) + offsets[1:] = max_docs_per_batch[:-1].cumsum(0) + doc_ids = doc_ids + offsets.unsqueeze(1) + doc_ids_flat = doc_ids.reshape(-1) # (B*L,) + # Exclude padding positions + pad_mask = (input_ids.reshape(-1) != self.pad_token_id) + num_docs = doc_ids_flat.max().item() + doc_ids_0based = doc_ids_flat - 1 + doc_embeds = [] + for doc_idx in range(num_docs): + mask = (doc_ids_0based == doc_idx) & pad_mask + if mask.any(): + doc_embeds.append(x_flat[mask].mean(dim=0)) + return torch.stack(doc_embeds, dim=0) + else: + # Legacy 1D path + docs = (input_ids == self.cls_token_id).cumsum(0) + x = x.view(-1, self.config.hidden_size) + num_docs = docs.max().item() + doc_ids = docs - 1 + doc_embeds = [] + for doc_idx in range(num_docs): + mask = (doc_ids == doc_idx) + doc_embeds.append(x[mask].mean(dim=0)) + return torch.stack(doc_embeds, dim=0) + + def forward( + self, + input_ids: torch.Tensor, + attention_mask: Optional[torch.Tensor] = None, + labels: Optional[torch.Tensor] = None, + mask_rate: Optional[torch.Tensor] = None, + sliding_window_size: Optional[int] = None, + output_hidden_states: Optional[bool] = None, + return_dict: Optional[bool] = None, + **kwargs, + ) -> MaskedLMOutput: + """Run masked-language-model inference or training. + + The public contract follows ``AutoModelForMaskedLM``: batched + ``input_ids`` and ``attention_mask`` are accepted, ``labels`` are + optional, and outputs expose ``loss`` and ``logits`` through a standard + ``MaskedLMOutput``. One-dimensional packed input remains supported for + the repository's legacy training pipeline. + """ + if sliding_window_size is None: + sliding_window_size = self.sliding_window_size + if return_dict is None: + return_dict = self.config.use_return_dict + if output_hidden_states is None: + output_hidden_states = self.config.output_hidden_states + + last_hidden_state = self.get_last_hidden_state( + input_ids, + sliding_window_size, + attention_mask=attention_mask, + ) + lm_logits = self.lm_head(norm(last_hidden_state)) + + loss = None + if labels is not None: + if labels.shape != input_ids.shape: + raise ValueError( + "labels must have the same shape as input_ids; " + f"got {labels.shape} and {input_ids.shape}." + ) + loss = self.ce( + lm_logits.reshape(-1, self.vocab_size), + labels.reshape(-1).long(), + ) + if self.training and self.masked_diffusion and not self.mlm: + if mask_rate is None: + valid_tokens = self._validated_attention_mask(input_ids, attention_mask) + predicted_tokens = (labels != -100) & valid_tokens + mask_rate = ( + predicted_tokens.sum().float() + / valid_tokens.sum().float().clamp(min=1) + ) + rate = torch.as_tensor( + mask_rate, + device=loss.device, + dtype=loss.dtype, + ).mean().clamp(min=torch.finfo(loss.dtype).eps) + loss = loss / rate + + hidden_states = (last_hidden_state,) if output_hidden_states else None + if not return_dict: + output = (lm_logits,) + if hidden_states is not None: + output += (hidden_states,) + return ((loss,) + output) if loss is not None else output + + return MaskedLMOutput( + loss=loss, + logits=lm_logits, + hidden_states=hidden_states, + ) + + @torch.no_grad() + def get_logits( + self, + input_ids: torch.Tensor, + sliding_window_size: Optional[int] = None, + attention_mask: Optional[torch.Tensor] = None, + ) -> torch.Tensor: + """Get LM logits without computing loss. + + Args: + input_ids: (B, L) for patch_unet or (total_len,) for standard/unet + sliding_window_size: Override sliding window size + + Returns: + Logits tensor with shape matching input + vocab dim + """ + if sliding_window_size is None: + sliding_window_size = self.sliding_window_size + hidden = self.get_last_hidden_state( + input_ids, + sliding_window_size, + attention_mask=attention_mask, + ) + return self.lm_head(norm(hidden)) + + @torch.no_grad() + def get_embeddings( + self, + input_ids: torch.Tensor, + sliding_window_size: Optional[int] = None, + pooling: str = 'mean', + ) -> torch.Tensor: + """Get per-sequence pooled embeddings. + + Args: + input_ids: (B, L) for patch_unet or (total_len,) for standard/unet + sliding_window_size: Override sliding window size + pooling: 'mean' for mean pooling over non-pad tokens, 'cls' for CLS token embedding + + Returns: + (num_sequences, hidden_size) embeddings + """ + if sliding_window_size is None: + sliding_window_size = self.sliding_window_size + hidden = self.get_last_hidden_state(input_ids, sliding_window_size) + + if self.patch_unet: + # Batched: hidden is (B, L, D), input_ids is (B, L) + assert input_ids.dim() == 2 + B, L, D = hidden.shape + if pooling == 'cls': + # CLS is the first token of each chunk + return hidden[:, 0, :] # (B, D) + else: + # Mean pool over non-pad tokens per batch element + mask = (input_ids != self.pad_token_id).unsqueeze(-1).float() # (B, L, 1) + return (hidden * mask).sum(dim=1) / mask.sum(dim=1).clamp(min=1) # (B, D) + else: + # Legacy 1D: hidden is (total_len, D) + if pooling == 'cls': + # Return embedding at each CLS position + cls_mask = (input_ids == self.cls_token_id) + return hidden[cls_mask] # (num_docs, D) + else: + # Mean pool per document + return self.get_vector_embeddings(input_ids, sliding_window_size) + + def save_weights_local(self, save_dir: str, step: int): + """Save model weights and optimizer-resumable checkpoint locally.""" + from pathlib import Path + save_path = Path(save_dir) + save_path.mkdir(parents=True, exist_ok=True) + self.save_pretrained(save_path / f"step_{step:06d}") + + +# Tell Transformers to copy these source files and emit canonical AutoClass +# mappings whenever config/model artifacts are saved for local or Hub use. +PLMConfig.register_for_auto_class() +PLM.register_for_auto_class("AutoModelForMaskedLM") + + +if __name__ == "__main__": + # py -m model.model + import sys + import io + sys.stdout = io.TextIOWrapper(sys.stdout.buffer, encoding='utf-8') + + print("=" * 80) + print("Testing Original UNet Transformer") + print("=" * 80) + config = PLMConfig( + hidden_size=768, + num_attention_heads=6, + num_hidden_layers=24, + expansion_ratio=8/3, + unet=True, + max_sequence_length=1024, + ) + model = PLM(config).cuda() + print(f"Model parameters: {sum(p.numel() for p in model.parameters()):,}") + + # Create test input with proper structure (CLS + sequence + EOS) - 1D for legacy path + seq_len = 128 + input_ids = torch.randint(4, 33, (seq_len,)).cuda() + input_ids[0] = 0 # CLS token + input_ids[-1] = 2 # EOS token + labels = input_ids.clone() + labels[labels != 32] = -100 + mask_rate = torch.tensor(0.15).cuda() + + loss = model(input_ids=input_ids, labels=labels, mask_rate=mask_rate).loss + print(f"Original UNet loss: {loss.item():.4f}") + + print("\n" + "=" * 80) + print("Testing Batched UNet Transformer (patch_unet)") + print("=" * 80) + max_length = 128 # Power of 2 for patch merging + patch_config = PLMConfig( + hidden_size=384, + num_attention_heads=6, + num_unet_layers=8, # 4 encoder + 4 decoder + num_extra_layers=2, + max_sequence_length=max_length, + expansion_ratio=8/3, + patch_unet=True, + ) + patch_model = PLM(patch_config).cuda() + print(f"Model parameters: {sum(p.numel() for p in patch_model.parameters()):,}") + + # Create batched test input (B, max_length) with packed documents per element + B = 4 + batched_ids = torch.randint(4, 33, (B, max_length)).cuda() + for b in range(B): + # Insert CLS at start and EOS at end of each chunk + batched_ids[b, 0] = 0 + batched_ids[b, max_length - 1] = 2 + # Add a second document boundary in the middle + mid = max_length // 2 + batched_ids[b, mid - 1] = 2 # EOS for doc 1 + batched_ids[b, mid] = 0 # CLS for doc 2 + batched_labels = batched_ids.clone() + batched_labels[batched_labels != 32] = -100 + + loss = patch_model( + input_ids=batched_ids, + labels=batched_labels, + mask_rate=mask_rate, + ).loss + print(f"Batched UNet loss: {loss.item():.4f}") + + print(f"\nHidden sizes: {patch_model.transformer.hidden_sizes}") + print(f"Vector depth (log2(max_length)): {patch_model.transformer.vector_depth}") + print(f"Num encoder layers: {patch_model.transformer.num_encoder_layers}") + print(f"Num decoder layers: {patch_model.transformer.num_decoder_layers}") + + print("\n" + "=" * 80) + print("Testing Batched UNet with deep layers (MLP at vector depth)") + print("=" * 80) + deep_config = PLMConfig( + hidden_size=384, + num_attention_heads=6, + num_unet_layers=20, # 10 encoder + 10 decoder (some will be MLPs) + num_extra_layers=1, + max_sequence_length=128, # log2(128)=7, so layers 7+ become MLPs + expansion_ratio=8/3, + patch_unet=True, + ) + deep_model = PLM(deep_config).cuda() + + # Count transformer vs MLP blocks + n_transformer = sum(1 for b in deep_model.transformer.encoder_blocks if isinstance(b, BatchedTransformerBlock)) + n_mlp = sum(1 for b in deep_model.transformer.encoder_blocks if isinstance(b, BottleneckMLP)) + print(f"Encoder: {n_transformer} transformer blocks, {n_mlp} MLP blocks") + + n_transformer_dec = sum(1 for b in deep_model.transformer.decoder_blocks if isinstance(b, BatchedTransformerBlock)) + n_mlp_dec = sum(1 for b in deep_model.transformer.decoder_blocks if isinstance(b, BottleneckMLP)) + print(f"Decoder: {n_transformer_dec} transformer blocks, {n_mlp_dec} MLP blocks") + + loss = deep_model( + input_ids=batched_ids, + labels=batched_labels, + mask_rate=mask_rate, + ).loss + print(f"Deep Batched UNet loss: {loss.item():.4f}") + + print("\n" + "=" * 80) + print("Testing Multi-Resolution Mask Pre-computation") + print("=" * 80) + + # Verify mask shapes at each resolution level + masks = precompute_multiresolution_masks( + input_ids=batched_ids, + cls_token_id=0, + pad_token_id=1, + num_levels=patch_model.transformer.num_resolution_levels, + sliding_window_size=128, + n_heads=6, + device=batched_ids.device, + ) + for i, m in enumerate(masks): + if m is not None: + print(f"Level {i}: mask shape Q_LEN={m.shape[-2]}, KV_LEN={m.shape[-1]}") + else: + print(f"Level {i}: None (vector depth)") + + print("\n" + "=" * 80) + print("All tests passed!") + print("=" * 80) diff --git a/src/speedrunning_plms/optim/__init__.py b/src/speedrunning_plms/optim/__init__.py new file mode 100644 index 000000000..ef37b7674 --- /dev/null +++ b/src/speedrunning_plms/optim/__init__.py @@ -0,0 +1,3 @@ +from speedrunning_plms.optim.muon import Muon, zeropower_via_newtonschulz5 + +__all__ = ["Muon", "zeropower_via_newtonschulz5"] diff --git a/src/speedrunning_plms/optim/muon.py b/src/speedrunning_plms/optim/muon.py new file mode 100644 index 000000000..a310eb247 --- /dev/null +++ b/src/speedrunning_plms/optim/muon.py @@ -0,0 +1,120 @@ +import os +import torch +import torch.distributed as dist + + +### Muon optimizer +@torch.compile +def zeropower_via_newtonschulz5(G, steps): + """ + Newton-Schulz iteration to compute the zeroth power / orthogonalization of G. We opt to use a + quintic iteration whose coefficients are selected to maximize the slope at zero. For the purpose + of minimizing steps, it turns out to be empirically effective to keep increasing the slope at + zero even beyond the point where the iteration no longer converges all the way to one everywhere + on the interval. This iteration therefore does not produce UV^T but rather something like US'V^T + where S' is diagonal with S_{ii}' ~ Uniform(0.5, 1.5), which turns out not to hurt model + performance at all relative to UV^T, where USV^T = G is the SVD. + """ + assert len(G.shape) == 2 + a, b, c = (3.4445, -4.7750, 2.0315) + X = G.bfloat16() + if G.size(0) > G.size(1): + X = X.T + + # Ensure spectral norm is at most 1 + X = X / (X.norm() + 1e-7) + # Perform the NS iterations + for _ in range(steps): + A = X @ X.T + B = b * A + c * A @ A # adapted from suggestion by @jxbz, @leloykun, and @YouJiacheng + X = a * X + B @ X + + if G.size(0) > G.size(1): + X = X.T + return X + + +class Muon(torch.optim.Optimizer): + """ + Muon - MomentUm Orthogonalized by Newton-schulz + + Muon internally runs standard SGD-momentum, and then performs an orthogonalization post- + processing step, in which each 2D parameter's update is replaced with the nearest orthogonal + matrix. To efficiently orthogonalize each update, we use a Newton-Schulz iteration, which has + the advantage that it can be stably run in bfloat16 on the GPU. + + Some warnings: + - This optimizer assumes that all parameters passed in are 2D. + - It should not be used for the embedding layer, the final fully connected layer, or any {0,1}-D + parameters; those should all be optimized by a standard method (e.g., AdamW). + - To use it with 4D convolutional filters, it works well to just flatten their last 3 dimensions. + - We believe it is unlikely to work well for training with small batch size. + - We believe it may not work well for finetuning pretrained models, but we haven't tested this. + - We have not yet tried this optimizer for training scenarios larger than NanoGPT (124M). + + Arguments: + lr: The learning rate used by the internal SGD. + momentum: The momentum used by the internal SGD. + nesterov: Whether to use Nesterov-style momentum in the internal SGD. (recommended) + ns_steps: The number of Newton-Schulz iteration steps to use. + """ + def __init__(self, params, lr=0.02, momentum=0.95, nesterov=True, ns_steps=5): + self.world_size = int(os.environ.get('WORLD_SIZE', '1')) + self.rank = int(os.environ.get('RANK', '0')) + defaults = dict(lr=lr, momentum=momentum, nesterov=nesterov, ns_steps=ns_steps) + params = list(params) + assert all(isinstance(p, torch.Tensor) for p in params) + sizes = {p.numel() for p in params} + param_groups = [ + { + 'params': [p for p in params if p.numel() == size], + 'update_buffer': [ + torch.empty(size, device='cuda', dtype=torch.bfloat16) + for _ in range(self.world_size) + ], + } + for size in sizes + ] + super().__init__(param_groups, defaults) + + def step(self): + for group in self.param_groups: + lr = group['lr'] + momentum = group['momentum'] + nesterov = group['nesterov'] + ns_steps = group['ns_steps'] + update_buffers = group['update_buffer'] + # generate weight updates in distributed fashion + params = group['params'] + assert len(params) % self.world_size == 0 + handle = None + params_world = None + def update_prev(): + if params_world is None: + return + if handle is not None: + handle.wait() + for p_world, g_world in zip(params_world, update_buffers): + p_world.data.add_( + g_world.view_as(p_world), + alpha=-lr * max(1, p_world.size(0) / p_world.size(1)) ** 0.5, + ) + for base_i in range(len(params))[::self.world_size]: + p = params[base_i + self.rank] + g = p.grad + assert g is not None + state = self.state[p] + if 'momentum_buffer' not in state: + state['momentum_buffer'] = torch.zeros_like(g) + buf = state['momentum_buffer'] + buf.lerp_(g, 1 - momentum) + g = g.lerp_(buf, momentum) if nesterov else buf + g = zeropower_via_newtonschulz5(g, steps=ns_steps).flatten() + update_prev() + if self.world_size > 1: + handle = dist.all_gather(update_buffers, g, async_op=True) + else: + update_buffers[0].copy_(g) + handle = None + params_world = params[base_i : base_i + self.world_size] + update_prev() diff --git a/src/speedrunning_plms/training/__init__.py b/src/speedrunning_plms/training/__init__.py new file mode 100644 index 000000000..4735432ca --- /dev/null +++ b/src/speedrunning_plms/training/__init__.py @@ -0,0 +1,27 @@ +__all__ = [ + "Trainer", + "apply_bugfix_overrides", + "arg_parser", + "build_model_config", + "validate_args", +] + + +def __getattr__(name: str): + if name in {"apply_bugfix_overrides", "build_model_config", "validate_args"}: + from speedrunning_plms.training.config import ( + apply_bugfix_overrides, + build_model_config, + validate_args, + ) + + return { + "apply_bugfix_overrides": apply_bugfix_overrides, + "build_model_config": build_model_config, + "validate_args": validate_args, + }[name] + if name in {"Trainer", "arg_parser"}: + from speedrunning_plms.training.trainer import Trainer, arg_parser + + return {"Trainer": Trainer, "arg_parser": arg_parser}[name] + raise AttributeError(name) diff --git a/src/speedrunning_plms/training/cli.py b/src/speedrunning_plms/training/cli.py new file mode 100644 index 000000000..12b26b480 --- /dev/null +++ b/src/speedrunning_plms/training/cli.py @@ -0,0 +1,42 @@ +from speedrunning_plms.training.runtime import * # noqa: F401,F403 +from speedrunning_plms.training.config import ( + apply_bugfix_overrides, + build_model_config, + validate_args, +) +from speedrunning_plms.training.trainer import Trainer, arg_parser, build_code_snapshot, set_code_snapshot + + +def main() -> None: + args = arg_parser() + apply_bugfix_overrides(args) + validate_args(args) + model_config = build_model_config(args) + + wandb_initialized = False + if args.wandb_token: + import os + + if os.environ.get("WANDB_AVAILABLE") == "true": + import wandb + + wandb.login(key=args.wandb_token) + wandb_initialized = True + + if args.hf_token: + from huggingface_hub import login + + login(args.hf_token) + args.hf_token = None + + if args.wandb_token: + args.wandb_token = None + + set_code_snapshot(build_code_snapshot()) + trainer = Trainer(args, model_config) + trainer.wandb_initialized = wandb_initialized + trainer.train() + + +if __name__ == "__main__": + main() diff --git a/src/speedrunning_plms/training/config.py b/src/speedrunning_plms/training/config.py new file mode 100644 index 000000000..0d56acebd --- /dev/null +++ b/src/speedrunning_plms/training/config.py @@ -0,0 +1,52 @@ +from argparse import Namespace + +from speedrunning_plms.models import PLMConfig + + +def apply_bugfix_overrides(args: Namespace) -> None: + if not args.bugfix: + return + args.hidden_size = 128 + args.num_attention_heads = 2 + args.num_hidden_layers = 2 + args.expansion_ratio = 2.0 + args.soft_logit_cap = 16.0 + args.tie_embeddings = False + args.unet = True + args.batch_size = 2048 + args.grad_accum = 1 + args.num_steps = 10 + args.cooldown_steps = 2 + args.max_length = 512 + args.auto_grad_clip = True + args.grad_clip = 0.0 + + +def validate_args(args: Namespace) -> None: + if args.mlm and args.masked_diffusion: + raise ValueError("Only one of --mlm or --masked_diffusion can be true.") + if args.auto_grad_clip and args.grad_clip > 0: + raise ValueError("Cannot use both --auto_grad_clip and --grad_clip at the same time. Choose one.") + if getattr(args, "push_to_hub", False) and not getattr(args, "hf_model_name", None): + raise ValueError("--hf_model_name is required when --push_to_hub is enabled.") + + +def build_model_config(args: Namespace) -> PLMConfig: + return PLMConfig( + hidden_size=args.hidden_size, + num_attention_heads=args.num_attention_heads, + num_hidden_layers=args.num_hidden_layers, + num_unet_layers=args.num_unet_layers, + num_extra_layers=args.num_extra_layers, + max_sequence_length=args.max_length, + vocab_size=args.vocab_size, + expansion_ratio=args.expansion_ratio, + soft_logit_cap=args.soft_logit_cap, + tie_embeddings=args.tie_embeddings, + unet=args.unet, + patch_unet=args.patch_unet, + mlm=args.mlm or args.masked_diffusion, + masked_diffusion=args.masked_diffusion, + token_dropout=args.token_dropout, + compile_flex_attention=args.compile_flex_attention, + ) diff --git a/src/speedrunning_plms/training/optimizers.py b/src/speedrunning_plms/training/optimizers.py new file mode 100644 index 000000000..5fc92c89e --- /dev/null +++ b/src/speedrunning_plms/training/optimizers.py @@ -0,0 +1,81 @@ +import torch +from transformers import get_scheduler + +from speedrunning_plms.optim import Muon +from speedrunning_plms.training.utils import LerpFloat, LerpTensor + + +def build_optimizers(model, args, print_fn=print): + if args.use_muon: + matrix_params = [ + p for n, p in model.named_parameters() + if p.ndim >= 2 and "embed" not in n.lower() and "lm_head" not in n.lower() and p.requires_grad + ] + embed_params = [ + p for n, p in model.named_parameters() if "embed" in n.lower() and p.requires_grad + ] + head_params = [ + p for n, p in model.named_parameters() if "lm_head" in n.lower() and p.requires_grad + ] + scalar_params = [ + p for n, p in model.named_parameters() + if p.ndim < 2 and "embed" not in n.lower() and "lm_head" not in n.lower() and p.requires_grad + ] + + all_params = [p for p in model.parameters() if p.requires_grad] + mapped_params = matrix_params + embed_params + head_params + scalar_params + assert len(all_params) == len(mapped_params), ( + f"Muon parameter mapping mismatch: {len(all_params)} total vs {len(mapped_params)} mapped" + ) + print_fn( + f"Muon optimizer initialized: {len(matrix_params)} matrix, {len(embed_params)} embed, " + f"{len(head_params)} head, {len(scalar_params)} scalar params. Total: {len(all_params)}" + ) + + optimizer1 = torch.optim.Adam([ + dict(params=embed_params, lr=args.lr_embed), + dict(params=head_params, lr=args.lr_head), + dict(params=scalar_params, lr=args.lr_scalar), + ], betas=(0.8, 0.95), fused=True) + optimizer2 = Muon(matrix_params, lr=args.lr_hidden, momentum=0.95) + return [optimizer1, optimizer2] + + params = [p for p in model.parameters() if p.requires_grad] + print_fn(f"AdamW optimizer initialized with {len(params)} parameters.") + return [torch.optim.AdamW(params, lr=args.lr)] + + +def build_schedulers(optimizers, args): + lr_schedulers = [] + adam_scheduler = get_scheduler( + args.scheduler_type, + optimizer=optimizers[0], + num_warmup_steps=args.lr_warmup_steps, + num_training_steps=args.num_steps, + ) + lr_schedulers.append(adam_scheduler) + if args.use_muon: + muon_scheduler = get_scheduler( + args.scheduler_type, + optimizer=optimizers[-1], + num_warmup_steps=0, + num_training_steps=args.num_steps, + ) + lr_schedulers.append(muon_scheduler) + + sliding_window_size_scheduler = LerpTensor(start_val=1024, end_val=args.max_length, precision=128) + if args.mask_rate_schedule: + mask_rate_scheduler = LerpFloat( + start_val=args.starting_mask_rate, + end_val=args.mask_rate, + precision=0.01, + ) + else: + mask_rate_scheduler = None + return lr_schedulers, sliding_window_size_scheduler, mask_rate_scheduler + + +def apply_muon_momentum_warmup(optimizer, step: int, warmup_steps: int) -> None: + frac = min(step / warmup_steps, 1) + for group in optimizer.param_groups: + group["momentum"] = (1 - frac) * 0.85 + frac * 0.95 diff --git a/src/speedrunning_plms/training/publishing.py b/src/speedrunning_plms/training/publishing.py new file mode 100644 index 000000000..fea1bb168 --- /dev/null +++ b/src/speedrunning_plms/training/publishing.py @@ -0,0 +1,87 @@ +"""Opt-in publication of complete trained-model artifacts.""" + +from pathlib import Path +from tempfile import TemporaryDirectory +from typing import Callable, Optional + + +REMOTE_CODE_REQUIREMENTS = "torch>=2.5\ntransformers>=4.57.6,<5\n" + + +def _unwrap_model(model): + """Remove DDP and torch.compile wrappers before serialization.""" + seen = set() + while id(model) not in seen: + seen.add(id(model)) + if hasattr(model, "module"): + model = model.module + continue + if hasattr(model, "_orig_mod"): + model = model._orig_mod + continue + break + return model + + +def publish_model_to_hub( + model, + repo_id: Optional[str], + *, + enabled: bool = False, + api_factory: Optional[Callable] = None, +): + """Publish one complete model snapshot in a single Hub commit. + + Nothing is imported from or sent to the Hub unless ``enabled`` is true. + The artifact is fully staged and validated before any external API call. + """ + if not enabled: + return None + if not repo_id: + raise ValueError("repo_id is required when Hub publication is enabled.") + + model = _unwrap_model(model) + with TemporaryDirectory() as tmpdir: + artifact_dir = Path(tmpdir) + model.save_pretrained(artifact_dir, safe_serialization=True) + (artifact_dir / "requirements.txt").write_text( + REMOTE_CODE_REQUIREMENTS, + encoding="utf-8", + ) + + files = { + path.relative_to(artifact_dir).as_posix() + for path in artifact_dir.rglob("*") + if path.is_file() + } + required = { + "config.json", + "plm.py", + "attention.py", + "layers.py", + "requirements.txt", + } + missing = required - files + if missing: + raise RuntimeError( + "Refusing to publish an incomplete model artifact; missing: " + + ", ".join(sorted(missing)) + ) + if not ({"model.safetensors", "pytorch_model.bin"} & files): + raise RuntimeError("Refusing to publish an artifact without model weights.") + + if api_factory is None: + from huggingface_hub import HfApi + + api_factory = HfApi + api = api_factory() + api.create_repo(repo_id=repo_id, repo_type="model", exist_ok=True) + return api.upload_folder( + folder_path=artifact_dir, + repo_id=repo_id, + repo_type="model", + commit_message="Publish final trained model artifact", + ) + + +__all__ = ["REMOTE_CODE_REQUIREMENTS", "publish_model_to_hub"] diff --git a/src/speedrunning_plms/training/runtime.py b/src/speedrunning_plms/training/runtime.py new file mode 100644 index 000000000..b2695a4b4 --- /dev/null +++ b/src/speedrunning_plms/training/runtime.py @@ -0,0 +1,66 @@ +import os + + +os.environ["TF_CPP_MIN_LOG_LEVEL"] = "2" # Only error/warning messages +os.environ["TF_ENABLE_ONEDNN_OPTS"] = "0" +os.environ['DISABLE_PANDERA_IMPORT_WARNING'] = 'true' +os.environ['HF_HUB_ENABLE_HF_TRANSFER'] = '1' +os.environ['HF_HUB_DISABLE_SYMLINKS_WARNING'] = '1' +os.environ['TOKENIZERS_PARALLELISM'] = 'true' + + +# if on a linux machine, set HF_HOME to the directory of the script +if os.name == 'linux' and "HF_HOME" not in os.environ: + os.environ['HF_HOME'] = os.path.dirname(os.path.abspath(__file__)) + + +# === PyTorch Performance Optimizations === +try: + import torch + import atexit + # Enable TensorFloat32 tensor cores for float32 matmul (Ampere+ GPUs) + # Provides significant speedup with minimal precision loss + torch.set_float32_matmul_precision('high') + + # Enable TF32 for matrix multiplications and cuDNN operations + torch.backends.cuda.matmul.allow_tf32 = True + torch.backends.cudnn.allow_tf32 = True + + # Enable cuDNN autotuner - finds fastest algorithms for your hardware + # Best when input sizes are consistent; may slow down first iterations + torch.backends.cudnn.benchmark = True + + # Deterministic operations off for speed (set True if reproducibility needed) + torch.backends.cudnn.deterministic = False + + + import torch._inductor.config as inductor_config + inductor_config.max_autotune_gemm_backends = "ATEN,CUTLASS,FBGEMM" + + try: + import torch._dynamo as dynamo + dynamo.config.capture_scalar_outputs = True + except Exception: + print("Failed to import torch._dynamo") + + # Ensure DDP process groups are destroyed on exit to avoid NCCL warnings. + try: + import torch.distributed as dist + def _cleanup_ddp(): + if dist.is_available() and dist.is_initialized(): + dist.destroy_process_group() + atexit.register(_cleanup_ddp) + except Exception: + pass + + + +except ImportError: + pass + + +try: + import wandb + os.environ["WANDB_AVAILABLE"] = 'true' +except ImportError: + os.environ["WANDB_AVAILABLE"] = 'false' \ No newline at end of file diff --git a/src/speedrunning_plms/training/trainer.py b/src/speedrunning_plms/training/trainer.py new file mode 100644 index 000000000..d60200388 --- /dev/null +++ b/src/speedrunning_plms/training/trainer.py @@ -0,0 +1,1000 @@ +import os +import sys + +import uuid +import contextlib +import subprocess +import math +import argparse +import numpy as np +import torch +import torch.distributed as dist + +from torch.nn.utils import clip_grad_norm_ +from torch.nn.parallel import DistributedDataParallel as DDP +from torchinfo import summary +from transformers import EsmTokenizer +from tqdm import tqdm +from pathlib import Path + +from speedrunning_plms.data.download import get as ensure_hf_file +from speedrunning_plms.models import PLM, PLMConfig +from speedrunning_plms.data.loaders import ( + OptimizedTrainLoader, + OptimizedEvalLoader, + ChunkedTrainLoader, + ChunkedEvalLoader, + AsyncBatchPipeline, + apply_masking_gpu, +) +from speedrunning_plms.training.config import ( + apply_bugfix_overrides, + build_model_config, + validate_args, +) +from speedrunning_plms.training.optimizers import ( + apply_muon_momentum_warmup, + build_optimizers, + build_schedulers, +) +from speedrunning_plms.training.publishing import publish_model_to_hub +from speedrunning_plms.training.utils import ( + set_seed, + load_config_from_yaml, + exclude_from_timer, + GlobalTimer, + AutoGradClipper +) + + +code = "" + + +def build_code_snapshot(script_path: str | None = None) -> str: + root = Path.cwd() + snapshot_parts = [] + candidate_paths = [ + Path(script_path) if script_path is not None else Path(sys.argv[0]), + root / "entrypoint_setup.py", + root / "optimizer.py", + root / "data" / "dataloading.py", + root / "model" / "utils.py", + root / "model" / "attention.py", + root / "model" / "model.py", + ] + candidate_paths.extend(sorted((root / "src" / "speedrunning_plms").glob("**/*.py"))) + for path in candidate_paths: + try: + snapshot_parts.append(Path(path).read_text(encoding="utf-8")) + except OSError: + continue + return "\n".join(snapshot_parts) + + +def set_code_snapshot(snapshot: str) -> None: + global code + code = snapshot + + +if os.environ.get('WANDB_AVAILABLE') == 'true': + import wandb + + +def arg_parser(): + parser = argparse.ArgumentParser(description="Synthyra Trainer") + parser.add_argument("--yaml_path", type=str, default=None, help="Path to YAML file") + + # CLI-specific arguments (always from CLI for security) + parser.add_argument("--hf_token", type=str, default=None, help="Huggingface token") + parser.add_argument("--wandb_token", type=str, default=None, help="Weights & Biases API token") + parser.add_argument("--log_name", type=str, default=None, help="Name of the log file, else will be randomly generated") + parser.add_argument("--bugfix", action="store_true", help="Use small batch size and max length for debugging") + + # All other arguments with defaults (can be overridden by YAML) + parser.add_argument("--save_path", type=str, default="Synthyra/speedrun_test", help="Path to save the model and report to wandb") + parser.add_argument("--data_name", type=str, default="uniref50", help="Dataset name: uniref50, omg_prot50, or og_prot90") + parser.add_argument("--num_chunks", type=int, default=100, help="Number of training chunks to ensure are downloaded") + + # Distributed training arguments + parser.add_argument("--seed", type=int, default=42, help="Random seed for reproducibility") + parser.add_argument("--clear_cache_every", type=int, default=1000, help="Clear CUDA cache every N steps") + parser.add_argument("--grad_clip", type=float, default=0.0, help="Gradient clipping value (0 to disable)") + parser.add_argument("--auto_grad_clip", action="store_true", help="Enable auto gradient clipping") + parser.add_argument("--auto_grad_clip_p", type=float, default=10.0, help="Percentile for auto gradient clipping") + + # Model hyperparams + parser.add_argument("--hidden_size", type=int, default=768, help="Hidden size of the model") + parser.add_argument("--num_attention_heads", type=int, default=6, help="Number of attention heads") + parser.add_argument("--num_hidden_layers", type=int, default=24, help="Number of hidden layers (for non-unet)") + parser.add_argument("--num_unet_layers", type=int, default=0, help="Number of Conv1D UNet layers (encoder + decoder)") + parser.add_argument("--num_extra_layers", type=int, default=0, help="Number of extra transformer layers after UNet") + parser.add_argument("--vocab_size", type=int, default=33, help="Vocabulary size") + parser.add_argument("--expansion_ratio", type=float, default=2.0, help="Expansion ratio for MLP") + parser.add_argument("--soft_logit_cap", type=float, default=32.0, help="Soft logit cap") + parser.add_argument("--tie_embeddings", action="store_true", help="Tie embeddings") + parser.add_argument("--unet", type=bool, default=True, help="Use UNet architecture (skip connections only)") + parser.add_argument("--patch_unet", action="store_true", help="Use Patch UNet with downsampling (Swin-style)") + parser.add_argument("--token_dropout", type=bool, default=True, help="Use token dropout") + parser.add_argument("--bfloat16", action="store_true", help="Use bfloat16") + parser.add_argument("--compile_model", type=bool, default=True, help="Use torch.compile on the full model") + parser.add_argument("--compile_flex_attention", type=bool, default=True, help="Compile flex_attention for fused attention") + parser.add_argument("--dynamo_recompile_limit", type=int, default=32, help="Dynamo recompile limit for torch.compile") + + # Data hyperparams + parser.add_argument("--mlm", action="store_true", help="Use masked language modeling") + parser.add_argument("--masked_diffusion", action="store_true", help="Use masked diffusion") + parser.add_argument("--mask_rate", type=float, default=0.2, help="Mask rate for masked language modeling") + parser.add_argument("--starting_mask_rate", type=float, default=0.1, help="Starting mask rate for masked language modeling") + parser.add_argument("--mask_rate_steps", type=int, default=2500, help="Number of steps to reach mask rate") + parser.add_argument("--mask_rate_schedule", action="store_true", help="Use mask rate schedule") + + # Optimization hyperparams + parser.add_argument("--batch_size", type=int, default=8*64*1024, help="Total batch size in tokens") + parser.add_argument("--grad_accum", type=int, default=1, help="Gradient accumulation steps") + parser.add_argument("--num_steps", type=int, default=50000, help="Number of training steps") + parser.add_argument("--cooldown_steps", type=int, default=5000, help="Number of cooldown steps") + parser.add_argument("--max_length", type=int, default=2048, help="Maximum sequence length") + parser.add_argument("--scheduler_type", type=str, default='cosine', help="Scheduler type") + parser.add_argument("--lr_warmup_steps", type=int, default=1000, help="Number of warmup steps") + + # Adam optimizer params + parser.add_argument("--lr", type=float, default=0.0001, help="Learning rate for Adam optimizer when not using Muon") + parser.add_argument("--lr_embed", type=float, default=0.001, help="Learning rate for embeddings") + parser.add_argument("--lr_head", type=float, default=0.001, help="Learning rate for head") + parser.add_argument("--lr_scalar", type=float, default=0.001, help="Learning rate for scalar params") + + # Muon optimizer params + parser.add_argument("--use_muon", action="store_true", help="Use Muon optimizer") + parser.add_argument("--lr_hidden", type=float, default=0.001, help="Learning rate for hidden layers (Muon)") + parser.add_argument("--muon_momentum_warmup_steps", type=int, default=300, help="Steps for warmup momentum (0.85 -> 0.95)") + + # Evaluation and logging hyperparams + parser.add_argument("--eval_every", type=int, default=1000, help="Evaluate on validation set every N steps") + parser.add_argument("--push_to_hub", action="store_true", help="Publish the final complete model artifact to Hugging Face Hub") + parser.add_argument("--hf_model_name", type=str, default=None, help="Hugging Face model repository used only with --push_to_hub") + parser.add_argument("--save_every", type=int, default=None, help="Save checkpoint every N steps") + + # Dataloader params + parser.add_argument("--num_workers", type=int, default=4, help="Number of workers for optimized dataloader") + parser.add_argument("--prefetch_factor", type=int, default=8, help="Prefetch factor for optimized dataloader") + + # Parse CLI args first + args = parser.parse_args() + + # Load YAML config if provided + if args.yaml_path: + yaml_config = load_config_from_yaml(args.yaml_path) + + # Security: Never load tokens from YAML files + cli_only_params = {'hf_token', 'wandb_token', 'yaml_path'} + + # Override defaults with YAML values, but preserve CLI overrides + for key, value in yaml_config.items(): + if key not in cli_only_params and hasattr(args, key): + # Only override if the argument wasn't explicitly provided via CLI + # Check if the current value is the default by comparing with parser defaults + action = next((action for action in parser._actions if action.dest == key), None) + if action and getattr(args, key) == action.default: + # Convert boolean strings to boolean values + if isinstance(action.default, bool) and isinstance(value, str): + value = value.lower() in ('true', '1', 'yes', 'on') + setattr(args, key, value) + + # Align input patterns to dataset if not already pointing at it + args.input_bin = f"data/{args.data_name}/{args.data_name}_train_*.bin" + args.input_valid_bin = f"data/{args.data_name}/{args.data_name}_valid_*.bin" + args.input_test_bin = f"data/{args.data_name}/{args.data_name}_test_*.bin" + return args + + +class Trainer: + def __init__(self, args, model_config): + self.args = args + self.model_config = model_config + + self.wandb_initialized = False + + # Initialize global timer + self.train_timer = GlobalTimer() + + # Initialize mask rate tracking (used directly for patch_unet GPU-side masking) + self.current_mask_rate = args.mask_rate if args.mlm else 1.0 + + # Initialize auto gradient clipper + self.auto_grad_clipper = None + self.last_clip_value = None + + if 'RANK' in os.environ: + self.ddp_rank = int(os.environ['RANK']) + self.ddp_local_rank = int(os.environ['LOCAL_RANK']) + self.ddp_world_size = int(os.environ['WORLD_SIZE']) + self.device = torch.device(f'cuda:{self.ddp_local_rank}') + torch.cuda.set_device(self.device) + dist.init_process_group(backend='nccl', device_id=self.device) + dist.barrier() + self.master_process = (self.ddp_rank == 0) + else: + self.ddp_rank = 0 + self.ddp_local_rank = 0 + self.ddp_world_size = 1 + self.device = torch.device('cuda:0') + torch.cuda.set_device(self.device) + self.master_process = True + + set_seed(self.args.seed) + + print(f'Process {self.ddp_rank}: using device: {self.device}') + + def print0(self, s, logonly=False): + if self.master_process: + with open(self.logfile, 'a', encoding='utf-8') as f: + if not logonly: + print(s) + print(s, file=f) + + def log_wandb(self, log_dict, prefix='train'): + if self.master_process and self.wandb_initialized: + wandb.log({f'{prefix}/{k}': v for k, v in log_dict.items()}) + + @staticmethod + def _update_confusion(confusion: torch.Tensor, preds: torch.Tensor, labels: torch.Tensor): + valid_mask = labels != -100 + if not valid_mask.any(): + return + valid_preds = preds[valid_mask].view(-1).to(dtype=torch.int64, device='cpu') + valid_labels = labels[valid_mask].view(-1).to(dtype=torch.int64, device='cpu') + num_classes = confusion.shape[0] + indices = valid_labels * num_classes + valid_preds + counts = torch.bincount(indices, minlength=num_classes * num_classes) + confusion += counts.view(num_classes, num_classes) + + @staticmethod + def _calculate_metrics_from_confusion(confusion: torch.Tensor): + total = int(confusion.sum().item()) + if total == 0: + return { + "accuracy": 0.0, + "precision": 0.0, + "recall": 0.0, + "f1": 0.0, + "mcc": 0.0, + "num_tokens": 0, + } + confusion_f = confusion.to(dtype=torch.float64) + tp = torch.diag(confusion_f) + actual = confusion_f.sum(dim=1) + predicted = confusion_f.sum(dim=0) + precision = torch.where(predicted > 0, tp / predicted, torch.zeros_like(tp)) + recall = torch.where(actual > 0, tp / actual, torch.zeros_like(tp)) + f1 = torch.where( + precision + recall > 0, + 2.0 * precision * recall / (precision + recall), + torch.zeros_like(tp), + ) + weighted_precision = (precision * actual).sum().item() / total + weighted_recall = (recall * actual).sum().item() / total + weighted_f1 = (f1 * actual).sum().item() / total + correct = tp.sum().item() + numerator = correct * total - (predicted * actual).sum().item() + denom_left = total * total - (predicted * predicted).sum().item() + denom_right = total * total - (actual * actual).sum().item() + if denom_left <= 0 or denom_right <= 0: + mcc = 0.0 + else: + mcc = numerator / math.sqrt(denom_left * denom_right) + return { + "accuracy": correct / total, + "precision": weighted_precision, + "recall": weighted_recall, + "f1": weighted_f1, + "mcc": mcc, + "num_tokens": total, + } + + @staticmethod + def _read_bin_num_tokens(path): + with open(path, "rb") as f: + header = np.fromfile(f, dtype=np.int32, count=3) + if header.size < 3: + raise ValueError(f"Invalid header in {path}") + return int(header[2]) + + def _print_val_preview(self, input_ids: torch.Tensor, labels: torch.Tensor, logits: torch.Tensor): + if not self.master_process: + return + pad_token_id = self.pad_token_id + # Flatten batched tensors to 1D for preview + if input_ids.dim() == 2: + input_ids = input_ids.view(-1) + if labels.dim() == 2: + labels = labels.view(-1) + if logits.dim() == 3: + logits = logits.view(-1, logits.shape[-1]) + assert input_ids.dim() == 1, f"Expected input_ids to be 1D (seq_len,) but got: {input_ids.shape}" + assert labels.dim() == 1, f"Expected labels to be 1D (seq_len,) but got: {labels.shape}" + assert logits.dim() == 2, f"Expected logits to be 2D (seq_len, vocab_size) but got: {logits.shape}" + assert input_ids.shape[0] == labels.shape[0], f"input_ids/labels length mismatch: {input_ids.shape[0]} != {labels.shape[0]}" + assert logits.shape[0] == input_ids.shape[0], f"logits/input_ids length mismatch: {logits.shape[0]} != {input_ids.shape[0]}" + input_ids = input_ids.cpu() + labels = labels.cpu() + logits = logits.cpu() + masked_positions = (labels != -100).nonzero(as_tuple=True)[0] + if masked_positions.numel() == 0: + self.print0("Validation preview: no masked positions in selected batch.") + return + + preds = logits.argmax(dim=-1).to(dtype=input_ids.dtype) + filled = input_ids.clone() + filled[masked_positions] = preds[masked_positions] + + original = input_ids.clone() + original[masked_positions] = labels[masked_positions] + + def _strip_pad(ids): + if (ids == pad_token_id).any(): + last_valid = (ids != pad_token_id).nonzero(as_tuple=True)[0][-1].item() + return ids[: last_valid + 1] + return ids + + input_ids = _strip_pad(input_ids) + original = _strip_pad(original) + filled = _strip_pad(filled) + + decoded_input = self.tokenizer.decode(input_ids.tolist()[:128], skip_special_tokens=False).replace(" ", "").replace("", "-") + decoded_original = self.tokenizer.decode(original.tolist()[:128], skip_special_tokens=False).replace(" ", "") + decoded_filled = self.tokenizer.decode(filled.tolist()[:128], skip_special_tokens=False).replace(" ", "").replace("", "-") + + masked_list = masked_positions.tolist()[:10] + self.print0("=" * 128, logonly=True) + self.print0("VALIDATION PREVIEW (single example)", logonly=True) + self.print0(f"Masked positions:\n{masked_list} ...", logonly=True) + self.print0(f"Raw input ids:\n{input_ids.tolist()[:10]} ...", logonly=True) + self.print0(f"Raw original ids:\n{original.tolist()[:10]} ...", logonly=True) + self.print0(f"Raw filled ids:\n{filled.tolist()[:10]} ...", logonly=True) + self.print0("-" * 128, logonly=True) + self.print0(f"Decoded input:\n{decoded_input}", logonly=True) + self.print0(f"Decoded original:\n{decoded_original}", logonly=True) + self.print0(f"Decoded filled:\n{decoded_filled}", logonly=True) + self.print0("=" * 128, logonly=True) + + def init_training(self): + self.logfile = None + if self.master_process: + os.makedirs('logs', exist_ok=True) + + # Use provided log_name or generate a random UUID + if self.args.log_name: + run_id = self.args.log_name + else: + run_id = str(uuid.uuid4()) + log_filename = f'{run_id}.txt' + + self.logfile = os.path.join('logs', log_filename) + print(os.path.basename(self.logfile)) + # create the log file + with open(self.logfile, 'w', encoding='utf-8') as f: + # begin the log by printing this file (the Python code) + print(code, file=f) + print('=' * 100, file=f) + + # Synchronize before initializing wandb + if self.ddp_world_size > 1: + dist.barrier() + + if self.master_process and self.wandb_initialized: + wandb.init( + project="speedrunning-plms", + name=run_id, + config={ + **vars(self.args), + **vars(self.model_config), + "ddp_world_size": self.ddp_world_size, + "device": str(self.device) + } + ) + + self.print0(f'Running python {sys.version}') + self.print0(f'Running pytorch {torch.version.__version__} compiled for CUDA {torch.version.cuda}\nnvidia-smi:') + result = subprocess.run(['nvidia-smi'], stdout=subprocess.PIPE, stderr=subprocess.PIPE, text=True) + self.print0(f'{result.stdout}', logonly=True) + self.print0('='*100, logonly=True) + + # Log configuration source + if self.args.yaml_path: + self.print0(f'Configuration loaded from YAML: {self.args.yaml_path}') + self.print0('CLI arguments override YAML where provided (tokens always from CLI for security)') + else: + self.print0('Configuration from CLI arguments only') + self.print0('='*50) + + self.print0(f'Model config:\n{self.model_config}') + self.print0('Args:') + for k, v in self.args.__dict__.items(): + self.print0(f'{k}: {v}') + self.print0('='*100, logonly=True) + + # calculate local batch size + self.batch_size = self.args.batch_size // self.args.grad_accum // self.ddp_world_size + + self.print0(f'Train accumulation steps: {self.args.grad_accum}') + self.print0(f'Adjusted local batch size: {self.batch_size} tokens') + self.print0(f'Across {self.ddp_world_size} GPUs') + self.print0(f'Total batch size: {self.args.batch_size} tokens') + + self.tokenizer = EsmTokenizer.from_pretrained('facebook/esm2_t6_8M_UR50D') + self.pad_token_id = self.tokenizer.pad_token_id + self.mask_token_id = self.tokenizer.mask_token_id + # Special tokens tensor for GPU-side masking (moved to GPU lazily) + self._special_tokens_cpu = torch.tensor( + [self.tokenizer.cls_token_id, self.tokenizer.eos_token_id, self.pad_token_id], + dtype=torch.int32, + ) + + # Ensure dataset is available locally (master process only), then sync + if self.master_process: + self.print0(f"Ensuring dataset '{self.args.data_name}' is available (num_chunks={self.args.num_chunks})...") + try: + ensure_hf_file(f"{self.args.data_name}_valid_%06d.bin" % 0, self.args.data_name) + ensure_hf_file(f"{self.args.data_name}_test_%06d.bin" % 0, self.args.data_name) + for i in tqdm(range(0, self.args.num_chunks + 1), desc="Ensuring dataset chunks"): + ensure_hf_file(f"{self.args.data_name}_train_%06d.bin" % i, self.args.data_name) + except Exception as e: + self.print0(f"Dataset ensure failed: {e}") + if self.ddp_world_size > 1: + dist.barrier() + + self.train_loader = self.init_dataloader(self.args.input_bin, training=True) + self.valid_loader = self.init_dataloader(self.args.input_valid_bin, training=False) + self.test_loader = self.init_dataloader(self.args.input_test_bin, training=False) + + self.print0(f'Training DataLoader: {len(self.train_loader.files)} files') + self.print0(f'Validation DataLoader: {len(self.valid_loader.files)} files') + self.print0(f'Testing DataLoader: {len(self.test_loader.files)} files') + self.print0('='*100, logonly=True) + + if self.master_process: + train_files = sorted(Path.cwd().glob(self.args.input_bin)) + self.total_downloaded_tokens = sum(self._read_bin_num_tokens(f) for f in train_files) + else: + self.total_downloaded_tokens = 0 + if self.ddp_world_size > 1: + total_tokens_tensor = torch.tensor(self.total_downloaded_tokens, device=self.device) + dist.broadcast(total_tokens_tensor, 0) + self.total_downloaded_tokens = int(total_tokens_tensor.item()) + self.epoch_counter = 1 + + self.model = self.init_model() + self.print0(summary(self.model)) + + # Initialize auto gradient clipper if enabled + if self.args.auto_grad_clip: + model_for_clipper = self.model.module if self.ddp_world_size > 1 else self.model + self.auto_grad_clipper = AutoGradClipper( + model=model_for_clipper, + clip_percentile=self.args.auto_grad_clip_p, + ) + self.print0(f"Auto gradient clipping enabled with {self.args.auto_grad_clip_p}% percentile") + + self.optimizers = self.init_optimizers() + self.lr_schedulers, self.sliding_window_size_scheduler, self.mask_rate_scheduler = self.init_schedulers() + self.print0(f"Ready for training!") + + # Create decorated versions of methods that should be excluded from timing + self._run_eval_loader_timed = exclude_from_timer(self.train_timer)(self.run_eval_loader) + self._save_checkpoint_timed = exclude_from_timer(self.train_timer)(self.save_checkpoint) + + def init_dataloader(self, filename_pattern, training=True): + if self.args.patch_unet: + # Chunked loader for batched UNet: yields (B, max_length) raw input_ids + if training: + loader = ChunkedTrainLoader( + filename_pattern=filename_pattern, + max_length=self.args.max_length, + micro_batch_tokens=self.batch_size, + process_rank=self.ddp_rank, + num_processes=self.ddp_world_size, + max_epochs=1, + tokenizer=self.tokenizer, + num_workers=self.args.num_workers, + prefetch_factor=self.args.prefetch_factor, + ) + return AsyncBatchPipeline(loader) + else: + loader = ChunkedEvalLoader( + filename_pattern=filename_pattern, + max_length=self.args.max_length, + micro_batch_tokens=self.batch_size, + process_rank=self.ddp_rank, + num_processes=self.ddp_world_size, + tokenizer=self.tokenizer, + ) + return AsyncBatchPipeline(loader) + else: + # Legacy loader for standard/unet: yields (input_ids, labels, mask_rate) + if training: + if self.args.mlm: + mask_rate = self.args.mask_rate + else: + mask_rate = 1.0 + return OptimizedTrainLoader( + filename_pattern=filename_pattern, + seq_len=self.batch_size, + process_rank=self.ddp_rank, + num_processes=self.ddp_world_size, + max_epochs=1, + tokenizer=self.tokenizer, + num_workers=self.args.num_workers, + prefetch_factor=self.args.prefetch_factor, + mlm=self.args.mlm or self.args.masked_diffusion, + mask_rate=mask_rate, + ) + else: + return OptimizedEvalLoader( + filename_pattern=filename_pattern, + seq_len=self.batch_size, + process_rank=self.ddp_rank, + num_processes=self.ddp_world_size, + tokenizer=self.tokenizer, + ) + + def init_model(self): + self.print0("Initializing model...") + model = PLM(self.model_config) + self.print0(model) + model = model.cuda() + if self.args.bfloat16: + model = model.bfloat16() + + # Synchronize before compilation + if self.ddp_world_size > 1: + dist.barrier() + + if self.args.compile_model: + self.print0("Calling torch.compile()") + torch._dynamo.config.recompile_limit = self.args.dynamo_recompile_limit + model = torch.compile(model) + else: + self.print0("Skipping torch.compile()") + + if self.ddp_world_size > 1: + # Use static graph if model architecture doesn't change + model = DDP(model, device_ids=[self.ddp_local_rank], broadcast_buffers=False, gradient_as_bucket_view=True) + return model + + def init_optimizers(self): + self.print0("Initializing optimizers...") + return build_optimizers(self.model, self.args, print_fn=self.print0) + + def init_schedulers(self): + self.print0("Initializing schedulers...") + return build_schedulers(self.optimizers, self.args) + + @torch.no_grad() + def run_eval_loader(self, loader, prefix='val'): # returns loss, tokens + # Synchronize before evaluation + if self.ddp_world_size > 1: + dist.barrier() + + loader.reset() + self.model.eval() + + # Move special tokens to GPU once + special_tokens_gpu = self._special_tokens_cpu.to(self.device) + + losses, total_tokens = [], 0 + confusion = torch.zeros((self.args.vocab_size, self.args.vocab_size), dtype=torch.int64) + preview_done = False + + if self.args.patch_unet: + # Chunked loader: yields (B, max_length) raw input_ids on GPU + raw_ids = loader.next_batch() + else: + # Legacy loader: yields (input_ids, labels, mask_rate) on GPU + input_ids, labels, mask_rate = loader.next_batch() + raw_ids = input_ids # Use input_ids for the loop condition + + # Only show progress bar on master process + pbar = tqdm(desc=f'{prefix} set', leave=False, disable=not self.master_process) + + while raw_ids.numel(): + if self.args.patch_unet: + # Apply masking on GPU with fixed eval mask rate + input_ids, labels, mask_rate = apply_masking_gpu( + raw_ids, special_tokens_gpu, self.mask_token_id, mask_rate=0.15, mlm=True, + ) + batch_valid_tokens = (input_ids != self.pad_token_id).sum() + total_tokens += batch_valid_tokens + outputs = self.model( + input_ids=input_ids, + labels=labels, + mask_rate=mask_rate, + sliding_window_size=self.sliding_window_size, + ) + loss = outputs.loss + logits = outputs.logits + losses.append(loss.item()) + preds = logits.argmax(dim=-1) + self._update_confusion(confusion, preds.detach(), labels.detach()) + if not preview_done: + self._print_val_preview(input_ids, labels, logits) + preview_done = True + + if self.args.patch_unet: + raw_ids = loader.next_batch() + else: + input_ids, labels, mask_rate = loader.next_batch() + raw_ids = input_ids + pbar.update(1) + pbar.close() + + avg_loss = sum(losses) / len(losses) if losses else 0.0 + + metrics = self._calculate_metrics_from_confusion(confusion) + + if self.ddp_world_size > 1: + # Convert to tensors before all_reduce + avg_loss = torch.tensor(avg_loss, device=self.device) + total_tokens = torch.tensor(total_tokens, device=self.device) + dist.all_reduce(avg_loss, op=dist.ReduceOp.AVG) + dist.all_reduce(total_tokens, op=dist.ReduceOp.SUM) + # Ensure all processes finish evaluation + dist.barrier() + + perplexity = math.e**avg_loss if isinstance(avg_loss, float) else math.e**avg_loss.item() + + self.print0( + f'{prefix} set: loss: {avg_loss:.4f} perplexity: {perplexity:.4f} ' + f'tokens: {total_tokens.item() if hasattr(total_tokens, "item") else total_tokens:,}' + ) + self.print0( + f"{prefix} metrics: acc:{metrics['accuracy']:.4f} prec:{metrics['precision']:.4f} " + f"rec:{metrics['recall']:.4f} f1:{metrics['f1']:.4f} mcc:{metrics['mcc']:.4f} " + f"tokens:{metrics['num_tokens']:,}" + ) + + return avg_loss, perplexity, total_tokens, metrics + + def save_checkpoint(self, step): + # Only master saves, but all processes wait + if self.master_process: + self.print0(f'Saving checkpoint at step {step}...') + + if self.ddp_world_size > 1: + model = self.model.module + else: + model = self.model + + # Always save locally + log = dict(step=step, model=model.state_dict(), optimizers=[opt.state_dict() for opt in self.optimizers]) + os.makedirs('logs', exist_ok=True) + torch.save(log, 'logs/state_step%06d.pt' % step) + model.save_weights_local('checkpoints', step) + self.print0(f'Checkpoint saved locally at step {step}') + + # Synchronize after saving + if self.ddp_world_size > 1: + dist.barrier() + + def publish_final_artifact(self): + """Publish only the final, fully trained artifact when explicitly enabled.""" + if not self.master_process: + return None + if self.args.push_to_hub: + self.print0( + f"Publishing final model artifact to {self.args.hf_model_name}..." + ) + result = publish_model_to_hub( + self.model, + self.args.hf_model_name, + enabled=self.args.push_to_hub, + ) + if self.args.push_to_hub: + self.print0("Final model artifact published to the Hub.") + return result + + def train_step(self, step): + self.model.train() + + # Clear cache periodically to prevent memory fragmentation + if step % self.args.clear_cache_every == 0: + torch.cuda.empty_cache() + + # Move special tokens to GPU once (cached after first call) + if not hasattr(self, '_special_tokens_gpu'): + self._special_tokens_gpu = self._special_tokens_cpu.to(self.device) + + # Accumulate losses for proper averaging + accumulated_loss = 0.0 + + for i in range(self.args.grad_accum): + with contextlib.ExitStack() as stack: + # Only sync gradients on last accumulation step + if self.ddp_world_size > 1 and i < self.args.grad_accum - 1: + stack.enter_context(self.model.no_sync()) + + if self.args.patch_unet: + # Chunked pipeline: yields raw (B, max_length) on GPU + raw_ids = self.train_loader.next_batch() + if raw_ids.numel() == 0: + self.train_loader.reset() + raw_ids = self.train_loader.next_batch() + assert raw_ids.numel() > 0, "Dataloader returned empty batch even after reset" + # Apply masking on GPU + input_ids, labels, mask_rate = apply_masking_gpu( + raw_ids, + self._special_tokens_gpu, + self.mask_token_id, + mask_rate=self.current_mask_rate, + mlm=self.args.mlm or (self.args.masked_diffusion and self.current_mask_rate < 1.0), + ) + else: + # Legacy pipeline: yields (input_ids, labels, mask_rate) on GPU + input_ids, labels, mask_rate = self.train_loader.next_batch() + if input_ids.numel() == 0: + self.train_loader.reset() + input_ids, labels, mask_rate = self.train_loader.next_batch() + assert input_ids.numel() > 0, "Dataloader returned empty batch even after reset" + + outputs = self.model( + input_ids=input_ids, + labels=labels, + mask_rate=mask_rate, + sliding_window_size=self.sliding_window_size, + ) + loss = outputs.loss / self.args.grad_accum + loss.backward() + accumulated_loss += loss.item() # Accumulate the scaled loss + + # momentum warmup for Muon + if self.args.use_muon: + apply_muon_momentum_warmup( + self.optimizers[-1], + step=step, + warmup_steps=self.args.muon_momentum_warmup_steps, + ) + + # Apply gradient clipping if specified + clip_value = None + if self.args.auto_grad_clip and self.auto_grad_clipper is not None: + # Use auto gradient clipping + clip_value = self.auto_grad_clipper.clip_gradients() + elif self.args.grad_clip > 0: + # Use regular gradient clipping + if self.ddp_world_size > 1: + clip_grad_norm_(self.model.module.parameters(), self.args.grad_clip) + else: + clip_grad_norm_(self.model.parameters(), self.args.grad_clip) + clip_value = self.args.grad_clip + + # step the optimizers and schedulers + for opt, sched in zip(self.optimizers, self.lr_schedulers): + opt.step() + sched.step() + + # null the gradients + self.model.zero_grad(set_to_none=True) + + # Store clip value for logging + self.last_clip_value = clip_value + + # Return the total accumulated loss (already properly scaled) + return accumulated_loss + + def train(self): + self.init_training() + + train_losses = [] + + ### BEGIN TRAINING LOOP ### + self.print0("Beginning training loop...") + + # Synchronize before starting training + if self.ddp_world_size > 1: + dist.barrier() + + # Show progress only on master + pbar = tqdm(range(self.args.num_steps + 1), desc='Training steps', disable=not self.master_process) + + try: + for step in pbar: + if step == 10: # ignore first 10 steps of timing because they are slower + self.train_timer.reset() + self.train_timer.start() + timed_steps = float('nan') if step <= 11 else (step - 10) + 1 # <= 11 to avoid bug in val + + frac_done = step / self.args.num_steps # training progress + if frac_done > 1: + self.sliding_window_size = self.args.max_length + else: + self.sliding_window_size = self.sliding_window_size_scheduler(frac_done) + + if self.mask_rate_scheduler: + frac_done_mask = step / self.args.mask_rate_steps + if frac_done_mask > 1: + mask_rate = self.args.mask_rate + else: + mask_rate = self.mask_rate_scheduler(frac_done_mask) + self.current_mask_rate = mask_rate + if self.args.patch_unet: + # For patch_unet, mask_rate is applied in train_step via apply_masking_gpu + if self.args.masked_diffusion and frac_done_mask > 1: + model_for_mlm = self.model.module if self.ddp_world_size > 1 else self.model + model_for_mlm.mlm = False + else: + # Legacy path: push mask_rate to data loader workers + self.train_loader.set_mask_rate(mask_rate) + if self.args.masked_diffusion and frac_done_mask > 1 and self.train_loader.mlm: + self.train_loader.set_mlm(False) + model_for_mlm = self.model.module if self.ddp_world_size > 1 else self.model + model_for_mlm.mlm = False + # once in a while evaluate the validation dataset + if self.args.eval_every > 0 and step % self.args.eval_every == 0: + val_loss, val_perplexity, val_tokens, val_metrics = self._run_eval_loader_timed( + self.valid_loader, prefix='Validation' + ) + training_time_sec = self.train_timer.get_time() + step_avg_ms = 1000 * training_time_sec / (timed_steps - 1) if timed_steps > 1 else 0 + self.print0(f'step:{step}/{self.args.num_steps} step_avg:{step_avg_ms:.2f}ms') + tokens_seen = (step + 1) * self.args.batch_size + epoch_progress = tokens_seen / max(self.total_downloaded_tokens, 1) + current_epoch = int(epoch_progress) + 1 + if current_epoch != self.epoch_counter: + self.print0(f"(MOVING FROM EPOCH {self.epoch_counter} TO EPOCH {current_epoch})") + self.epoch_counter = current_epoch + self.print0( + f"Epoch progress: {epoch_progress:.4f} " + f"({tokens_seen:,}/{self.total_downloaded_tokens:,} tokens)" + ) + self.log_wandb( + { + 'loss': val_loss, + 'perplexity': val_perplexity, + 'tokens': val_tokens, + 'sliding_window_size': self.sliding_window_size, + 'accuracy': val_metrics['accuracy'], + 'precision': val_metrics['precision'], + 'recall': val_metrics['recall'], + 'f1': val_metrics['f1'], + 'mcc': val_metrics['mcc'], + 'epoch_progress': epoch_progress, + }, + prefix='val' + ) + + # save checkpoint every `save_every` steps + if self.args.save_every: + if step % self.args.save_every == 0: + self._save_checkpoint_timed(step) + + loss = self.train_step(step) + train_losses.append(loss) + + # everything that follows now is just eval, diagnostics, prints, logging, etc. + if step % 100 == 0: + train_time_sec = self.train_timer.get_time() + avg_loss = sum(train_losses) / len(train_losses) + + # Gather training loss across all processes for accurate logging + if self.ddp_world_size > 1: + avg_loss_tensor = torch.tensor(avg_loss, device=self.device) + dist.all_reduce(avg_loss_tensor, op=dist.ReduceOp.AVG) + avg_loss = avg_loss_tensor.item() + + log_msg = f'step:{step+1}/{self.args.num_steps} train_time:{train_time_sec:.0f} sec step_avg:{1000*train_time_sec/timed_steps:.2f}ms loss:{avg_loss:.4f} mask_rate:{self.current_mask_rate:.4f}' + if hasattr(self, 'last_clip_value') and self.last_clip_value is not None: + log_msg += f' clip_value:{self.last_clip_value:.4f}' + self.print0(log_msg) + train_losses = [] + + # Log training progress to wandb + if self.master_process and self.wandb_initialized: + log_dict = { + "time_sec": train_time_sec, + "step_avg_ms": 1000*train_time_sec/timed_steps if timed_steps > 0 else 0, + "step": step, + "loss": avg_loss, + "mask_rate": self.current_mask_rate + } + if hasattr(self, 'last_clip_value') and self.last_clip_value is not None: + log_dict["clip_value"] = self.last_clip_value + self.log_wandb(log_dict, prefix='train') + + # Stop the timer and get final training time + self.train_timer.pause() + final_training_time_sec = self.train_timer.get_time() + + self.print0(f'peak memory consumption training: {torch.cuda.max_memory_allocated() // 1024 // 1024 // 1024} GiB') + self.print0(f'Train Time: {final_training_time_sec:.0f}s | Step Avg: {final_training_time_sec/timed_steps:.2f}s') + self.print0(f'Total train time (min): {final_training_time_sec / 60:.2f}') + self.print0(f'Total train time (hours): {final_training_time_sec / 3600:.2f}') + # Save final checkpoint locally + self._save_checkpoint_timed(self.args.num_steps) + + torch.cuda.empty_cache() + torch.cuda.synchronize() + set_seed(self.args.seed) + + test_loss, test_perplexity, test_tokens, test_metrics = self._run_eval_loader_timed( + self.test_loader, prefix='Test' + ) + + self.print0(f"peak memory consumption testing: {torch.cuda.max_memory_allocated() // 1024 // 1024 // 1024} GiB") + + # Final wandb logging + if self.master_process and self.wandb_initialized: + log_dict = { + "test_loss": test_loss, + "test_perplexity": test_perplexity, + "test_tokens": test_tokens.item() if hasattr(test_tokens, "item") else test_tokens, + "test_accuracy": test_metrics['accuracy'], + "test_precision": test_metrics['precision'], + "test_recall": test_metrics['recall'], + "test_f1": test_metrics['f1'], + "test_mcc": test_metrics['mcc'], + "final_train_time_sec": final_training_time_sec, + "final_step_avg_sec": final_training_time_sec/(timed_steps-1) if timed_steps > 1 else 0, + "peak_memory_training_gb": torch.cuda.max_memory_allocated() // 1024 // 1024 // 1024, + } + self.log_wandb(log_dict, prefix='test') + + # Log final summary + log_dict = { + "val_loss": val_loss, + "test_loss": test_loss, + "test_perplexity": test_perplexity, + "train_time_sec": final_training_time_sec, + "step_avg_sec": final_training_time_sec/(timed_steps-1) if timed_steps > 1 else 0, + "peak_memory_training_gb": torch.cuda.max_memory_allocated() // 1024 // 1024 // 1024, + } + self.log_wandb(log_dict, prefix='final') + + # The Hub sees one complete artifact only after training, local + # checkpointing, final evaluation, and final logging all succeed. + self.publish_final_artifact() + + except KeyboardInterrupt: + self.print0("\nTraining interrupted by user!") + except Exception as e: + self.print0(f"\nTraining failed with error: {e}") + import traceback + traceback.print_exc() + finally: + # Clean up resources + if self.master_process and self.wandb_initialized: + wandb.finish() + + # clean up nice + if self.ddp_world_size > 1: + dist.destroy_process_group() + + +def main(): + args = arg_parser() + apply_bugfix_overrides(args) + validate_args(args) + model_config = build_model_config(args) + + # Initialize wandb before clearing tokens for security + wandb_initialized = False + if args.wandb_token and os.environ.get('WANDB_AVAILABLE') == 'true': + wandb.login(key=args.wandb_token) + wandb_initialized = True + + if args.hf_token: + from huggingface_hub import login + login(args.hf_token) + # Clear tokens for security + args.hf_token = None + + # Clear wandb token for security but keep track that we logged in + if args.wandb_token: + args.wandb_token = None + + set_code_snapshot(build_code_snapshot()) + trainer = Trainer(args, model_config) + trainer.wandb_initialized = wandb_initialized + trainer.train() + + +if __name__ == '__main__': + main() diff --git a/src/speedrunning_plms/training/utils.py b/src/speedrunning_plms/training/utils.py new file mode 100644 index 000000000..b1088b9a1 --- /dev/null +++ b/src/speedrunning_plms/training/utils.py @@ -0,0 +1,145 @@ +import torch +import random +import numpy as np +import time +import yaml + + +def _get_grad_norm(model): + total_norm = 0 + for p in model.parameters(): + if p.grad is not None: + param_norm = p.grad.data.norm(2) + total_norm += param_norm.item() ** 2 + total_norm = total_norm ** (1. / 2) + return total_norm + + +class AutoGradClipper: + # Auto gradient clipping that adapts based on gradient history. + # adapted from https://github.com/pseeth/autoclip/tree/master + + def __init__(self, model, clip_percentile=10, history_length=1000000): + self.model = model + self.clip_percentile = clip_percentile + self.history_length = history_length + self.grad_history = [] + + def clip_gradients(self): + """Clip gradients based on percentile of gradient history.""" + obs_grad_norm = _get_grad_norm(self.model) + self.grad_history.append(obs_grad_norm) + + # Keep history length manageable + if len(self.grad_history) > self.history_length: + self.grad_history = self.grad_history[-self.history_length:] + + # Only start clipping after we have some history + if len(self.grad_history) >= 10: + clip_value = np.percentile(self.grad_history, self.clip_percentile) + torch.nn.utils.clip_grad_norm_(self.model.parameters(), clip_value) + return clip_value + return None + + +def load_config_from_yaml(yaml_path): + """Load configuration from YAML file.""" + with open(yaml_path, 'r') as f: + config = yaml.safe_load(f) + return config or {} + + +def set_seed(seed): + """Set seed for reproducibility across all processes.""" + random.seed(seed) + np.random.seed(seed) + torch.manual_seed(seed) + torch.cuda.manual_seed(seed) + + +def get_param_count(model): + total_params = 0 + for _, param in model.named_parameters(): + total_params += param.numel() + return total_params + + +class LerpTensor: + def __init__(self, start_val, end_val, precision): + self.start, self.end, self.prec = start_val, end_val, precision + self.prev_val = None + dtype = torch.int32 if isinstance(precision, int) else torch.float + self.gpu_val = torch.tensor(0, dtype=dtype, device="cuda") + + def __call__(self, frac_done): + val = (max((1 - frac_done), 0) * self.start + min(frac_done, 1) * self.end) // self.prec * self.prec + if val != self.prev_val: + self.gpu_val.copy_(val, non_blocking=True) + self.prev_val = val + return self.gpu_val + + +class LerpFloat: + def __init__(self, start_val, end_val, precision): + self.start, self.end, self.prec = start_val, end_val, precision + self.prev_val = None + + def __call__(self, frac_done): + val = (max((1 - frac_done), 0) * self.start + min(frac_done, 1) * self.end) // self.prec * self.prec + if val != self.prev_val: + self.prev_val = val + return self.prev_val + + +class GlobalTimer: + """Global timer that tracks elapsed time and can be paused/resumed.""" + def __init__(self): + self.total_time = 0.0 + self.start_time = None + self.is_running = False + + def start(self): + """Start the timer.""" + if not self.is_running: + torch.cuda.synchronize() + self.start_time = time.perf_counter() + self.is_running = True + + def pause(self): + """Pause the timer and add elapsed time to total.""" + if self.is_running: + torch.cuda.synchronize() + self.total_time += time.perf_counter() - self.start_time + self.is_running = False + + def resume(self): + """Resume the timer.""" + self.start() + + def get_time(self): + """Get total elapsed time including current session if running.""" + current_time = self.total_time + if self.is_running: + torch.cuda.synchronize() + current_time += time.perf_counter() - self.start_time + return current_time + + def reset(self): + """Reset the timer to zero.""" + self.total_time = 0.0 + self.start_time = None + self.is_running = False + + +def exclude_from_timer(timer): + """Decorator that pauses the timer during function execution.""" + def decorator(func): + def wrapper(*args, **kwargs): + timer.pause() + try: + result = func(*args, **kwargs) + finally: + timer.resume() + return result + return wrapper + return decorator diff --git a/tests/test_benchmark_manifest.py b/tests/test_benchmark_manifest.py new file mode 100644 index 000000000..68e63f584 --- /dev/null +++ b/tests/test_benchmark_manifest.py @@ -0,0 +1,124 @@ +import json +import os +import subprocess +import sys +from pathlib import Path + +import pytest + +from speedrunning_plms.evaluation import ( + download_dataset_split, + load_benchmark_manifest, + load_benchmark_model, + load_benchmark_tokenizer, +) +from speedrunning_plms.evaluation.benchmark_assets import FULL_COMMIT_SHA + + +ROOT = Path(__file__).resolve().parents[1] +MANIFEST_PATH = ROOT / "evaluation" / "benchmark_manifest.json" + + +def test_manifest_pins_every_asset_to_a_full_commit_sha(): + manifest = load_benchmark_manifest(MANIFEST_PATH) + + assets = [manifest["tokenizer"], *manifest["models"], *manifest["datasets"]] + assert len(assets) == 11 + for asset in assets: + assert FULL_COMMIT_SHA.fullmatch(asset["revision"]) + + +def test_manifest_rejects_mutable_revision(tmp_path): + manifest = json.loads(MANIFEST_PATH.read_text(encoding="utf-8")) + manifest["models"][0]["revision"] = "main" + path = tmp_path / "mutable.json" + path.write_text(json.dumps(manifest), encoding="utf-8") + + with pytest.raises(ValueError, match="full 40-character commit SHA"): + load_benchmark_manifest(path) + + +def test_benchmark_entrypoint_loads_manifest_aware_code(): + env = os.environ.copy() + env["PYTHONPATH"] = str(ROOT / "src") + completed = subprocess.run( + [sys.executable, "-m", "evaluation.benchmark_esm", "--help"], + cwd=ROOT, + env=env, + capture_output=True, + text=True, + timeout=120, + ) + assert completed.returncode == 0, completed.stdout + completed.stderr + assert "--manifest" in completed.stdout + + +def test_full_shas_propagate_to_every_hub_loader(): + manifest = load_benchmark_manifest(MANIFEST_PATH) + + model_calls = [] + + class RecordingModelLoader: + @classmethod + def from_pretrained(cls, repo_id, **kwargs): + model_calls.append((repo_id, kwargs)) + return repo_id + + for asset in manifest["models"]: + assert load_benchmark_model( + asset, + auto_model_cls=RecordingModelLoader, + ) == asset["repo_id"] + + assert len(model_calls) == len(manifest["models"]) + for asset, (repo_id, kwargs) in zip(manifest["models"], model_calls): + assert repo_id == asset["repo_id"] + assert kwargs == { + "trust_remote_code": True, + "revision": asset["revision"], + "code_revision": asset["revision"], + } + + tokenizer_calls = [] + + class RecordingTokenizerLoader: + @classmethod + def from_pretrained(cls, repo_id, **kwargs): + tokenizer_calls.append((repo_id, kwargs)) + return repo_id + + tokenizer = manifest["tokenizer"] + assert load_benchmark_tokenizer( + tokenizer, + auto_tokenizer_cls=RecordingTokenizerLoader, + ) == tokenizer["repo_id"] + assert tokenizer_calls == [ + (tokenizer["repo_id"], {"revision": tokenizer["revision"]}) + ] + + dataset_calls = [] + + def recording_download(**kwargs): + dataset_calls.append(kwargs) + return kwargs["filename"] + + for asset in manifest["datasets"]: + for split in ("valid", "test"): + assert download_dataset_split( + asset, + split, + downloader=recording_download, + ) == asset["filename"].format(split=split) + + assert len(dataset_calls) == 2 * len(manifest["datasets"]) + for asset, calls in zip( + manifest["datasets"], + (dataset_calls[index:index + 2] for index in range(0, len(dataset_calls), 2)), + ): + for split, kwargs in zip(("valid", "test"), calls): + assert kwargs == { + "repo_id": asset["repo_id"], + "filename": asset["filename"].format(split=split), + "repo_type": "dataset", + "revision": asset["revision"], + } diff --git a/tests/test_data_contracts.py b/tests/test_data_contracts.py new file mode 100644 index 000000000..e45ac0f8d --- /dev/null +++ b/tests/test_data_contracts.py @@ -0,0 +1,87 @@ +import os +import sys +import tempfile +import unittest +from pathlib import Path + +import numpy as np +import torch + +ROOT = Path(__file__).resolve().parents[1] +SRC = ROOT / "src" +if str(SRC) not in sys.path: + sys.path.insert(0, str(SRC)) + +from speedrunning_plms.data import TokenIds, read_shard_num_tokens, read_shard_tokens, write_shard +from speedrunning_plms.data.loaders import ChunkedTrainDataset, EvalLoader + + +TOKEN_IDS = TokenIds(cls_token_id=0, eos_token_id=2, pad_token_id=1, mask_token_id=32) + + +class DataContractTests(unittest.TestCase): + def test_shard_round_trip_preserves_header_contract(self): + with tempfile.TemporaryDirectory() as tmpdir: + path = Path(tmpdir) / "tiny.bin" + tokens = np.array([0, 5, 2, 0, 6, 2], dtype=np.uint8) + write_shard(path, tokens) + + self.assertEqual(read_shard_num_tokens(path), len(tokens)) + torch.testing.assert_close(read_shard_tokens(path), torch.tensor(tokens, dtype=torch.uint8)) + + def test_eval_loader_accepts_token_ids_and_yields_cpu_masked_batch(self): + with tempfile.TemporaryDirectory() as tmpdir: + cwd = Path.cwd() + os.chdir(tmpdir) + try: + data_dir = Path("data") + data_dir.mkdir() + write_shard(data_dir / "tiny_valid_000000.bin", np.array([0, 5, 2, 0, 6, 2], dtype=np.uint8)) + torch.manual_seed(0) + dataset = EvalLoader( + filename_pattern="data/tiny_valid_*.bin", + seq_len=6, + process_rank=0, + num_processes=1, + tokenizer=TOKEN_IDS, + ) + input_ids, labels, mask_rate = next(iter(dataset)) + finally: + os.chdir(cwd) + + self.assertEqual(tuple(input_ids.shape), (6,)) + self.assertEqual(tuple(labels.shape), (6,)) + self.assertEqual(tuple(mask_rate.shape), (1,)) + self.assertTrue(torch.all(labels[(input_ids == TOKEN_IDS.cls_token_id)] == -100)) + + def test_chunked_train_dataset_preserves_chunk_shape(self): + with tempfile.TemporaryDirectory() as tmpdir: + cwd = Path.cwd() + os.chdir(tmpdir) + try: + data_dir = Path("data") + data_dir.mkdir() + write_shard( + data_dir / "tiny_train_000000.bin", + np.array([0, 5, 2, 0, 6, 2, 0, 7, 2, 0, 8, 2], dtype=np.uint8), + ) + dataset = ChunkedTrainDataset( + filename_pattern="data/tiny_train_*.bin", + max_length=4, + batch_size=2, + process_rank=0, + num_processes=1, + max_epochs=1, + tokenizer=TOKEN_IDS, + num_workers=1, + ) + batch = next(iter(dataset)) + finally: + os.chdir(cwd) + + self.assertEqual(tuple(batch.shape), (2, 4)) + self.assertEqual(batch.dtype, torch.int32) + + +if __name__ == "__main__": + unittest.main() diff --git a/tests/test_hf_serialization.py b/tests/test_hf_serialization.py new file mode 100644 index 000000000..d9b45c904 --- /dev/null +++ b/tests/test_hf_serialization.py @@ -0,0 +1,307 @@ +import json +import inspect +import os +import subprocess +import sys +import textwrap +from pathlib import Path + +import pytest +import torch + +from speedrunning_plms.models import PLM, PLMConfig +from speedrunning_plms.training.publishing import publish_model_to_hub + + +def tiny_config(**overrides) -> PLMConfig: + values = { + "hidden_size": 8, + "num_attention_heads": 2, + "num_hidden_layers": 2, + "vocab_size": 33, + "unet": False, + "compile_flex_attention": False, + "tokenizer_name": None, + "cls_token_id": 0, + "eos_token_id": 2, + "pad_token_id": 1, + "mask_token_id": 32, + } + values.update(overrides) + return PLMConfig(**values) + + +@pytest.fixture +def tiny_model() -> PLM: + torch.manual_seed(7) + return PLM(tiny_config()) + + +def test_config_save_has_canonical_autoclass_metadata(tmp_path): + config = tiny_config(auto_map={"AutoModel": "legacy.Unsupported"}) + config.save_pretrained(tmp_path) + + saved = json.loads((tmp_path / "config.json").read_text(encoding="utf-8")) + assert saved["model_type"] == "speedrunning_plm" + assert saved["auto_map"] == { + "AutoConfig": "plm.PLMConfig", + "AutoModelForMaskedLM": "plm.PLM", + } + assert {"plm.py", "attention.py", "layers.py"}.issubset( + path.name for path in tmp_path.iterdir() + ) + + for source_name in ("plm.py", "attention.py", "layers.py"): + source = (tmp_path / source_name).read_text(encoding="utf-8") + assert "from speedrunning_plms" not in source + assert "model--PLM" not in source + assert "torchinfo" not in source + assert "huggingface_hub" not in source + + +def test_direct_pretrained_round_trip_preserves_config_and_weights(tiny_model, tmp_path): + checkpoint = tmp_path / "checkpoint" + tiny_model.save_pretrained(checkpoint) + + restored = PLM.from_pretrained(checkpoint, local_files_only=True) + + assert restored.config.model_type == "speedrunning_plm" + assert restored.config.tokenizer_name is None + assert restored.tokenizer is None + assert restored.state_dict().keys() == tiny_model.state_dict().keys() + for key, expected in tiny_model.state_dict().items(): + torch.testing.assert_close(restored.state_dict()[key], expected) + + +def test_tied_embedding_round_trip_preserves_parameter_sharing(tmp_path): + model = PLM(tiny_config(tie_embeddings=True)) + checkpoint = tmp_path / "tied-checkpoint" + + assert model.embedding.weight is model.lm_head.decoder.weight + model.save_pretrained(checkpoint) + restored = PLM.from_pretrained(checkpoint, local_files_only=True) + + assert restored.config.tie_word_embeddings is True + assert restored.embedding.weight is restored.lm_head.decoder.weight + torch.testing.assert_close(restored.embedding.weight, model.embedding.weight) + + +def test_save_weights_local_uses_zero_padded_step_directory(tiny_model, tmp_path): + tiny_model.save_weights_local(tmp_path, step=42) + + checkpoint = tmp_path / "step_000042" + assert (checkpoint / "config.json").is_file() + restored = PLM.from_pretrained(checkpoint, local_files_only=True) + torch.testing.assert_close(restored.embedding.weight, tiny_model.embedding.weight) + + +def test_masked_lm_contract_supports_batched_inference_attention_and_labels(): + model = PLM(tiny_config(num_hidden_layers=1)) + input_ids = torch.tensor( + [ + [0, 5, 32, 2, 1, 1], + [0, 7, 8, 32, 2, 1], + ] + ) + attention_mask = torch.tensor( + [ + [1, 1, 1, 1, 0, 0], + [1, 1, 1, 1, 1, 0], + ] + ) + + model.eval() + inference = model(input_ids=input_ids, attention_mask=attention_mask) + assert inference.loss is None + assert inference.logits.shape == (2, 6, 33) + + labels = torch.full_like(input_ids, -100) + labels[0, 2] = 9 + labels[1, 3] = 10 + model.train() + training = model( + input_ids=input_ids, + attention_mask=attention_mask, + labels=labels, + output_hidden_states=True, + ) + assert training.loss is not None + assert training.loss.ndim == 0 + assert training.logits.shape == (2, 6, 33) + assert training.hidden_states[0].shape == (2, 6, 8) + training.loss.backward() + assert model.embedding.weight.grad is not None + + tuple_output = model( + input_ids=input_ids, + attention_mask=attention_mask, + return_dict=False, + ) + assert tuple_output[0].shape == (2, 6, 33) + + +def test_autoclasses_load_saved_remote_code_without_installed_package(tmp_path): + checkpoint = tmp_path / "remote-checkpoint" + PLM(tiny_config(num_hidden_layers=1)).save_pretrained(checkpoint) + + script = textwrap.dedent( + f""" + import importlib.abc + import sys + + class BlockInstalledPackage(importlib.abc.MetaPathFinder): + def find_spec(self, fullname, path=None, target=None): + if fullname == "speedrunning_plms" or fullname.startswith("speedrunning_plms."): + raise ModuleNotFoundError("remote code imported the installed project package") + if fullname == "torchinfo" or fullname.startswith("torchinfo."): + raise ModuleNotFoundError("remote code imported optional torchinfo") + return None + + sys.meta_path.insert(0, BlockInstalledPackage()) + + import torch + from transformers import AutoConfig, AutoModelForMaskedLM + + checkpoint = {str(checkpoint)!r} + config = AutoConfig.from_pretrained( + checkpoint, + trust_remote_code=True, + local_files_only=True, + ) + assert config.__class__.__name__ == "PLMConfig" + assert config.model_type == "speedrunning_plm" + + masked_lm = AutoModelForMaskedLM.from_pretrained( + checkpoint, + trust_remote_code=True, + local_files_only=True, + ) + assert masked_lm.__class__.__name__ == "PLM" + assert tuple(masked_lm.lm_head.decoder.weight.shape) == (33, 8) + + input_ids = torch.tensor([[0, 5, 32, 2, 1], [0, 6, 32, 2, 1]]) + attention_mask = torch.tensor([[1, 1, 1, 1, 0], [1, 1, 1, 1, 0]]) + inference = masked_lm( + input_ids=input_ids, + attention_mask=attention_mask, + ) + assert inference.loss is None + assert tuple(inference.logits.shape) == (2, 5, 33) + + labels = torch.full_like(input_ids, -100) + labels[:, 2] = torch.tensor([7, 8]) + training = masked_lm( + input_ids=input_ids, + attention_mask=attention_mask, + labels=labels, + ) + assert training.loss.ndim == 0 + assert tuple(training.logits.shape) == (2, 5, 33) + """ + ) + env = os.environ.copy() + env.pop("PYTHONPATH", None) + env.update( + { + "HF_HOME": str(tmp_path / "hf-home"), + "HF_HUB_DISABLE_TELEMETRY": "1", + "HF_HUB_OFFLINE": "1", + "TRANSFORMERS_OFFLINE": "1", + } + ) + completed = subprocess.run( + [sys.executable, "-c", script], + cwd=tmp_path, + env=env, + capture_output=True, + text=True, + timeout=120, + ) + assert completed.returncode == 0, completed.stdout + completed.stderr + + +def test_hub_publication_is_disabled_by_default(tiny_model): + calls = [] + + def unexpected_api_factory(): + calls.append("api_factory") + raise AssertionError("The Hub API must not be constructed by default.") + + result = publish_model_to_hub( + tiny_model, + "Synthyra/test-model", + api_factory=unexpected_api_factory, + ) + + assert result is None + assert calls == [] + assert not hasattr(tiny_model, "push_code_and_config_to_hub") + assert not hasattr(tiny_model, "push_weights_to_hub") + + +def test_training_cli_requires_explicit_hub_opt_in(monkeypatch): + from speedrunning_plms.training.trainer import arg_parser + + monkeypatch.setattr(sys, "argv", ["speedrun-plm"]) + args = arg_parser() + + assert args.push_to_hub is False + assert args.hf_model_name is None + + +def test_trainer_publishes_only_after_final_evaluation(): + from speedrunning_plms.training.trainer import Trainer + + source = inspect.getsource(Trainer.train) + final_evaluation = source.rfind("self._run_eval_loader_timed") + publication = source.rfind("self.publish_final_artifact") + + assert final_evaluation >= 0 + assert publication > final_evaluation + + +def test_opted_in_hub_publication_is_one_complete_artifact(tiny_model): + calls = [] + + class RecordingApi: + def create_repo(self, **kwargs): + calls.append(("create_repo", kwargs)) + + def upload_folder(self, folder_path, **kwargs): + folder = Path(folder_path) + requirements = (folder / "requirements.txt").read_text(encoding="utf-8") + calls.append( + ( + "upload_folder", + kwargs, + {path.relative_to(folder).as_posix() for path in folder.rglob("*") if path.is_file()}, + json.loads((folder / "config.json").read_text(encoding="utf-8")), + requirements, + ) + ) + return {"commit": "final-artifact"} + + result = publish_model_to_hub( + tiny_model, + "Synthyra/test-model", + enabled=True, + api_factory=RecordingApi, + ) + + assert result == {"commit": "final-artifact"} + assert calls[0] == ( + "create_repo", + {"repo_id": "Synthyra/test-model", "repo_type": "model", "exist_ok": True}, + ) + assert len(calls) == 2 + _, upload_kwargs, files, config, requirements = calls[1] + assert upload_kwargs == { + "repo_id": "Synthyra/test-model", + "repo_type": "model", + "commit_message": "Publish final trained model artifact", + } + assert {"config.json", "plm.py", "attention.py", "layers.py", "requirements.txt"} <= files + assert {"model.safetensors", "pytorch_model.bin"} & files + assert config["auto_map"]["AutoModelForMaskedLM"] == "plm.PLM" + assert "AutoModel" not in config["auto_map"] + assert requirements == "torch>=2.5\ntransformers>=4.57.6,<5\n" diff --git a/tests/test_imports_and_models.py b/tests/test_imports_and_models.py new file mode 100644 index 000000000..5e03076c5 --- /dev/null +++ b/tests/test_imports_and_models.py @@ -0,0 +1,61 @@ +import sys +import unittest +from pathlib import Path + +ROOT = Path(__file__).resolve().parents[1] +SRC = ROOT / "src" +if str(ROOT) not in sys.path: + sys.path.insert(0, str(ROOT)) +if str(SRC) not in sys.path: + sys.path.insert(0, str(SRC)) + + +class ImportAndModelTests(unittest.TestCase): + def test_public_package_imports(self): + from speedrunning_plms import PLM, PLMConfig + from speedrunning_plms.data import ChunkPacker, LegacyFlatPacker, TokenIds, read_shard_tokens + from speedrunning_plms.flex import generate_dilated_sliding_window + from speedrunning_plms.optim import Muon + + self.assertIsNotNone(PLM) + self.assertIsNotNone(PLMConfig) + self.assertIsNotNone(ChunkPacker) + self.assertIsNotNone(LegacyFlatPacker) + self.assertIsNotNone(TokenIds) + self.assertIsNotNone(read_shard_tokens) + self.assertIsNotNone(generate_dilated_sliding_window) + self.assertIsNotNone(Muon) + + def test_root_compatibility_imports(self): + from data.dataloading import EvalLoader + from model.model import PLM, PLMConfig + from optimizer import Muon + + self.assertIsNotNone(EvalLoader) + self.assertIsNotNone(PLM) + self.assertIsNotNone(PLMConfig) + self.assertIsNotNone(Muon) + + def test_model_explicit_token_ids_avoid_tokenizer_requirement(self): + from speedrunning_plms.models import PLM, PLMConfig + + config = PLMConfig( + hidden_size=8, + num_attention_heads=2, + num_hidden_layers=2, + vocab_size=33, + unet=False, + compile_flex_attention=False, + tokenizer_name=None, + cls_token_id=0, + eos_token_id=2, + pad_token_id=1, + mask_token_id=32, + ) + model = PLM(config) + self.assertIsNone(model.tokenizer) + self.assertIn("embedding.weight", model.state_dict()) + + +if __name__ == "__main__": + unittest.main() diff --git a/tests/test_packaging.py b/tests/test_packaging.py new file mode 100644 index 000000000..7104bd186 --- /dev/null +++ b/tests/test_packaging.py @@ -0,0 +1,193 @@ +import email.parser +import os +import shutil +import site +import subprocess +import sys +import tarfile +import venv +import zipfile +from pathlib import Path + +import pytest + + +ROOT = Path(__file__).resolve().parents[1] + + +@pytest.fixture(scope="module") +def built_distributions(tmp_path_factory): + build_root = tmp_path_factory.mktemp("package-build") + source = build_root / "source" + source.mkdir() + + for filename in ( + "LICENSE", + "MANIFEST.in", + "README.md", + "pyproject.toml", + "requirements.txt", + ): + shutil.copy2(ROOT / filename, source / filename) + for directory in ("evaluation", "example_yamls", "src", "tests"): + shutil.copytree(ROOT / directory, source / directory) + + dist = build_root / "dist" + completed = subprocess.run( + [ + sys.executable, + "-m", + "build", + "--no-isolation", + "--sdist", + "--wheel", + "--outdir", + str(dist), + ], + cwd=source, + capture_output=True, + text=True, + timeout=180, + ) + assert completed.returncode == 0, completed.stdout + completed.stderr + + wheels = list(dist.glob("*.whl")) + sdists = list(dist.glob("*.tar.gz")) + assert len(wheels) == 1 + assert len(sdists) == 1 + return wheels[0], sdists[0], build_root + + +def test_wheel_contains_full_package_and_declares_runtime_dependencies(built_distributions): + wheel, _, _ = built_distributions + with zipfile.ZipFile(wheel) as archive: + names = set(archive.namelist()) + expected_modules = { + "speedrunning_plms/__init__.py", + "speedrunning_plms/data/loaders.py", + "speedrunning_plms/evaluation/benchmark_assets.py", + "speedrunning_plms/flex/mods.py", + "speedrunning_plms/models/plm.py", + "speedrunning_plms/optim/muon.py", + "speedrunning_plms/training/cli.py", + "speedrunning_plms/training/publishing.py", + } + assert expected_modules <= names + assert not any(name.startswith("tests/") for name in names) + + metadata_name = next(name for name in names if name.endswith(".dist-info/METADATA")) + metadata = email.parser.Parser().parsestr(archive.read(metadata_name).decode("utf-8")) + requirements = metadata.get_all("Requires-Dist", []) + assert metadata["Requires-Python"] == ">=3.10" + for dependency in ("datasets", "huggingface-hub", "numpy", "torch", "transformers"): + assert any(requirement.startswith(dependency) for requirement in requirements) + assert any('extra == "training"' in requirement for requirement in requirements) + assert any('extra == "evaluation"' in requirement for requirement in requirements) + assert any('extra == "test"' in requirement for requirement in requirements) + + +def test_sdist_contains_sources_tests_and_build_metadata(built_distributions): + _, sdist, _ = built_distributions + with tarfile.open(sdist, "r:gz") as archive: + names = {Path(name).as_posix() for name in archive.getnames()} + prefix = "speedrunning_plms-0.1.0/" + assert { + f"{prefix}LICENSE", + f"{prefix}MANIFEST.in", + f"{prefix}README.md", + f"{prefix}pyproject.toml", + f"{prefix}evaluation/benchmark_manifest.json", + f"{prefix}src/speedrunning_plms/evaluation/benchmark_assets.py", + f"{prefix}src/speedrunning_plms/models/plm.py", + f"{prefix}tests/test_benchmark_manifest.py", + f"{prefix}tests/test_hf_serialization.py", + } <= names + + +def test_installed_wheel_imports_and_console_entrypoint(built_distributions): + wheel, _, build_root = built_distributions + environment = build_root / "venv" + venv.EnvBuilder(with_pip=True).create(environment) + + if os.name == "nt": + python = environment / "Scripts" / "python.exe" + console = environment / "Scripts" / "speedrun-plm.exe" + else: + python = environment / "bin" / "python" + console = environment / "bin" / "speedrun-plm" + + # Reuse only the test runner's already-installed dependency directories. + # The child environment still owns the speedrunning_plms wheel, and .pth + # files from the parent environment are intentionally not reprocessed. + child_site = Path( + subprocess.check_output( + [str(python), "-c", "import site; print(site.getsitepackages()[0])"], + text=True, + ).strip() + ) + dependency_paths = [path for path in site.getsitepackages() if Path(path).is_dir()] + (child_site / "test-dependencies.pth").write_text( + "".join(f"{path}\n" for path in dependency_paths), + encoding="utf-8", + ) + + subprocess.run( + [ + str(python), + "-m", + "pip", + "install", + "--disable-pip-version-check", + "--no-index", + "--no-deps", + "--force-reinstall", + str(wheel), + ], + check=True, + capture_output=True, + text=True, + timeout=120, + ) + + smoke_dir = build_root / "smoke" + smoke_dir.mkdir() + env = os.environ.copy() + env.pop("PYTHONPATH", None) + script = """ +from importlib.metadata import version +from pathlib import Path + +import speedrunning_plms +from speedrunning_plms import PLM, PLMConfig +from speedrunning_plms.data import ChunkPacker +from speedrunning_plms.evaluation import load_benchmark_manifest +from speedrunning_plms.flex import generate_dilated_sliding_window +from speedrunning_plms.optim import Muon +from speedrunning_plms.training.publishing import publish_model_to_hub + +assert version("speedrunning-plms") == "0.1.0" +assert "site-packages" in Path(speedrunning_plms.__file__).as_posix() +assert all(item is not None for item in (PLM, PLMConfig, ChunkPacker, Muon)) +assert callable(generate_dilated_sliding_window) +assert callable(load_benchmark_manifest) +assert callable(publish_model_to_hub) +""" + completed = subprocess.run( + [str(python), "-c", script], + cwd=smoke_dir, + env=env, + capture_output=True, + text=True, + timeout=120, + ) + assert completed.returncode == 0, completed.stdout + completed.stderr + completed = subprocess.run( + [str(console), "--help"], + cwd=smoke_dir, + env=env, + capture_output=True, + text=True, + timeout=120, + ) + assert completed.returncode == 0, completed.stdout + completed.stderr + assert "Synthyra Trainer" in completed.stdout diff --git a/train.py b/train.py index d46850943..6f8bd0b04 100644 --- a/train.py +++ b/train.py @@ -1,1054 +1,14 @@ -import entrypoint_setup +import entrypoint_setup # noqa: F401 -import os import sys - -code = open(sys.argv[0]).read() -code += open('entrypoint_setup.py', 'r', encoding='utf-8').read() -code += open('optimizer.py', 'r', encoding='utf-8').read() -code += open('data/dataloading.py', 'r', encoding='utf-8').read() -code += open('model/utils.py', 'r', encoding='utf-8').read() -code += open('model/attention.py', 'r', encoding='utf-8').read() -code += open('model/model.py', 'r', encoding='utf-8').read() - -import uuid -import contextlib -import subprocess -import math -import argparse -import numpy as np -import torch -import torch.distributed as dist - -from torch.nn.utils import clip_grad_norm_ -from torch.nn.parallel import DistributedDataParallel as DDP -from torchinfo import summary -from transformers import EsmTokenizer, get_scheduler -from tqdm import tqdm from pathlib import Path -from data.download_data import get as ensure_hf_file -from model.model import PLM, PLMConfig -from data.dataloading import ( - OptimizedTrainLoader, - OptimizedEvalLoader, - ChunkedTrainLoader, - ChunkedEvalLoader, - AsyncBatchPipeline, - apply_masking_gpu, -) -from optimizer import Muon -from utils import ( - set_seed, - load_config_from_yaml, - exclude_from_timer, - GlobalTimer, - LerpTensor, - LerpFloat, - AutoGradClipper -) - - -if os.environ['WANDB_AVAILABLE'] == 'true': - import wandb - - -def arg_parser(): - parser = argparse.ArgumentParser(description="Synthyra Trainer") - parser.add_argument("--yaml_path", type=str, default=None, help="Path to YAML file") - - # CLI-specific arguments (always from CLI for security) - parser.add_argument("--hf_token", type=str, default=None, help="Huggingface token") - parser.add_argument("--wandb_token", type=str, default=None, help="Weights & Biases API token") - parser.add_argument("--log_name", type=str, default=None, help="Name of the log file, else will be randomly generated") - parser.add_argument("--bugfix", action="store_true", help="Use small batch size and max length for debugging") - - # All other arguments with defaults (can be overridden by YAML) - parser.add_argument("--save_path", type=str, default="Synthyra/speedrun_test", help="Path to save the model and report to wandb") - parser.add_argument("--data_name", type=str, default="uniref50", help="Dataset name: uniref50, omg_prot50, or og_prot90") - parser.add_argument("--num_chunks", type=int, default=100, help="Number of training chunks to ensure are downloaded") - - # Distributed training arguments - parser.add_argument("--seed", type=int, default=42, help="Random seed for reproducibility") - parser.add_argument("--clear_cache_every", type=int, default=1000, help="Clear CUDA cache every N steps") - parser.add_argument("--grad_clip", type=float, default=0.0, help="Gradient clipping value (0 to disable)") - parser.add_argument("--auto_grad_clip", action="store_true", help="Enable auto gradient clipping") - parser.add_argument("--auto_grad_clip_p", type=float, default=10.0, help="Percentile for auto gradient clipping") - - # Model hyperparams - parser.add_argument("--hidden_size", type=int, default=768, help="Hidden size of the model") - parser.add_argument("--num_attention_heads", type=int, default=6, help="Number of attention heads") - parser.add_argument("--num_hidden_layers", type=int, default=24, help="Number of hidden layers (for non-unet)") - parser.add_argument("--num_unet_layers", type=int, default=0, help="Number of Conv1D UNet layers (encoder + decoder)") - parser.add_argument("--num_extra_layers", type=int, default=0, help="Number of extra transformer layers after UNet") - parser.add_argument("--vocab_size", type=int, default=33, help="Vocabulary size") - parser.add_argument("--expansion_ratio", type=float, default=2.0, help="Expansion ratio for MLP") - parser.add_argument("--soft_logit_cap", type=float, default=32.0, help="Soft logit cap") - parser.add_argument("--tie_embeddings", action="store_true", help="Tie embeddings") - parser.add_argument("--unet", type=bool, default=True, help="Use UNet architecture (skip connections only)") - parser.add_argument("--patch_unet", action="store_true", help="Use Patch UNet with downsampling (Swin-style)") - parser.add_argument("--token_dropout", type=bool, default=True, help="Use token dropout") - parser.add_argument("--bfloat16", action="store_true", help="Use bfloat16") - parser.add_argument("--compile_model", type=bool, default=True, help="Use torch.compile on the full model") - parser.add_argument("--compile_flex_attention", type=bool, default=True, help="Compile flex_attention for fused attention") - parser.add_argument("--dynamo_recompile_limit", type=int, default=32, help="Dynamo recompile limit for torch.compile") - - # Data hyperparams - parser.add_argument("--mlm", action="store_true", help="Use masked language modeling") - parser.add_argument("--masked_diffusion", action="store_true", help="Use masked diffusion") - parser.add_argument("--mask_rate", type=float, default=0.2, help="Mask rate for masked language modeling") - parser.add_argument("--starting_mask_rate", type=float, default=0.1, help="Starting mask rate for masked language modeling") - parser.add_argument("--mask_rate_steps", type=int, default=2500, help="Number of steps to reach mask rate") - parser.add_argument("--mask_rate_schedule", action="store_true", help="Use mask rate schedule") - - # Optimization hyperparams - parser.add_argument("--batch_size", type=int, default=8*64*1024, help="Total batch size in tokens") - parser.add_argument("--grad_accum", type=int, default=1, help="Gradient accumulation steps") - parser.add_argument("--num_steps", type=int, default=50000, help="Number of training steps") - parser.add_argument("--cooldown_steps", type=int, default=5000, help="Number of cooldown steps") - parser.add_argument("--max_length", type=int, default=2048, help="Maximum sequence length") - parser.add_argument("--scheduler_type", type=str, default='cosine', help="Scheduler type") - parser.add_argument("--lr_warmup_steps", type=int, default=1000, help="Number of warmup steps") - - # Adam optimizer params - parser.add_argument("--lr", type=float, default=0.0001, help="Learning rate for Adam optimizer when not using Muon") - parser.add_argument("--lr_embed", type=float, default=0.001, help="Learning rate for embeddings") - parser.add_argument("--lr_head", type=float, default=0.001, help="Learning rate for head") - parser.add_argument("--lr_scalar", type=float, default=0.001, help="Learning rate for scalar params") - - # Muon optimizer params - parser.add_argument("--use_muon", action="store_true", help="Use Muon optimizer") - parser.add_argument("--lr_hidden", type=float, default=0.001, help="Learning rate for hidden layers (Muon)") - parser.add_argument("--muon_momentum_warmup_steps", type=int, default=300, help="Steps for warmup momentum (0.85 -> 0.95)") - - # Evaluation and logging hyperparams - parser.add_argument("--eval_every", type=int, default=1000, help="Evaluate on validation set every N steps") - parser.add_argument("--hf_model_name", type=str, default='lhallee/speedrun', help="Huggingface model name for saving") - parser.add_argument("--save_every", type=int, default=None, help="Save checkpoint every N steps") - - # Dataloader params - parser.add_argument("--num_workers", type=int, default=4, help="Number of workers for optimized dataloader") - parser.add_argument("--prefetch_factor", type=int, default=8, help="Prefetch factor for optimized dataloader") - - # Parse CLI args first - args = parser.parse_args() - - # Load YAML config if provided - if args.yaml_path: - yaml_config = load_config_from_yaml(args.yaml_path) - - # Security: Never load tokens from YAML files - cli_only_params = {'hf_token', 'wandb_token', 'yaml_path'} - - # Override defaults with YAML values, but preserve CLI overrides - for key, value in yaml_config.items(): - if key not in cli_only_params and hasattr(args, key): - # Only override if the argument wasn't explicitly provided via CLI - # Check if the current value is the default by comparing with parser defaults - action = next((action for action in parser._actions if action.dest == key), None) - if action and getattr(args, key) == action.default: - # Convert boolean strings to boolean values - if isinstance(action.default, bool) and isinstance(value, str): - value = value.lower() in ('true', '1', 'yes', 'on') - setattr(args, key, value) - - # Align input patterns to dataset if not already pointing at it - args.input_bin = f"data/{args.data_name}/{args.data_name}_train_*.bin" - args.input_valid_bin = f"data/{args.data_name}/{args.data_name}_valid_*.bin" - args.input_test_bin = f"data/{args.data_name}/{args.data_name}_test_*.bin" - return args - - -class Trainer: - def __init__(self, args, model_config): - self.args = args - self.model_config = model_config - - self.wandb_initialized = False - - # Initialize global timer - self.train_timer = GlobalTimer() - - # Initialize mask rate tracking (used directly for patch_unet GPU-side masking) - self.current_mask_rate = args.mask_rate if args.mlm else 1.0 - - # Initialize auto gradient clipper - self.auto_grad_clipper = None - self.last_clip_value = None - - if 'RANK' in os.environ: - self.ddp_rank = int(os.environ['RANK']) - self.ddp_local_rank = int(os.environ['LOCAL_RANK']) - self.ddp_world_size = int(os.environ['WORLD_SIZE']) - self.device = torch.device(f'cuda:{self.ddp_local_rank}') - torch.cuda.set_device(self.device) - dist.init_process_group(backend='nccl', device_id=self.device) - dist.barrier() - self.master_process = (self.ddp_rank == 0) - else: - self.ddp_rank = 0 - self.ddp_local_rank = 0 - self.ddp_world_size = 1 - self.device = torch.device('cuda:0') - torch.cuda.set_device(self.device) - self.master_process = True - - set_seed(self.args.seed) - - print(f'Process {self.ddp_rank}: using device: {self.device}') - - def print0(self, s, logonly=False): - if self.master_process: - with open(self.logfile, 'a', encoding='utf-8') as f: - if not logonly: - print(s) - print(s, file=f) - - def log_wandb(self, log_dict, prefix='train'): - if self.master_process and self.wandb_initialized: - wandb.log({f'{prefix}/{k}': v for k, v in log_dict.items()}) - - @staticmethod - def _update_confusion(confusion: torch.Tensor, preds: torch.Tensor, labels: torch.Tensor): - valid_mask = labels != -100 - if not valid_mask.any(): - return - valid_preds = preds[valid_mask].view(-1).to(dtype=torch.int64, device='cpu') - valid_labels = labels[valid_mask].view(-1).to(dtype=torch.int64, device='cpu') - num_classes = confusion.shape[0] - indices = valid_labels * num_classes + valid_preds - counts = torch.bincount(indices, minlength=num_classes * num_classes) - confusion += counts.view(num_classes, num_classes) - - @staticmethod - def _calculate_metrics_from_confusion(confusion: torch.Tensor): - total = int(confusion.sum().item()) - if total == 0: - return { - "accuracy": 0.0, - "precision": 0.0, - "recall": 0.0, - "f1": 0.0, - "mcc": 0.0, - "num_tokens": 0, - } - confusion_f = confusion.to(dtype=torch.float64) - tp = torch.diag(confusion_f) - actual = confusion_f.sum(dim=1) - predicted = confusion_f.sum(dim=0) - precision = torch.where(predicted > 0, tp / predicted, torch.zeros_like(tp)) - recall = torch.where(actual > 0, tp / actual, torch.zeros_like(tp)) - f1 = torch.where( - precision + recall > 0, - 2.0 * precision * recall / (precision + recall), - torch.zeros_like(tp), - ) - weighted_precision = (precision * actual).sum().item() / total - weighted_recall = (recall * actual).sum().item() / total - weighted_f1 = (f1 * actual).sum().item() / total - correct = tp.sum().item() - numerator = correct * total - (predicted * actual).sum().item() - denom_left = total * total - (predicted * predicted).sum().item() - denom_right = total * total - (actual * actual).sum().item() - if denom_left <= 0 or denom_right <= 0: - mcc = 0.0 - else: - mcc = numerator / math.sqrt(denom_left * denom_right) - return { - "accuracy": correct / total, - "precision": weighted_precision, - "recall": weighted_recall, - "f1": weighted_f1, - "mcc": mcc, - "num_tokens": total, - } - - @staticmethod - def _read_bin_num_tokens(path): - with open(path, "rb") as f: - header = np.fromfile(f, dtype=np.int32, count=3) - if header.size < 3: - raise ValueError(f"Invalid header in {path}") - return int(header[2]) - - def _print_val_preview(self, input_ids: torch.Tensor, labels: torch.Tensor, logits: torch.Tensor): - if not self.master_process: - return - pad_token_id = self.pad_token_id - # Flatten batched tensors to 1D for preview - if input_ids.dim() == 2: - input_ids = input_ids.view(-1) - if labels.dim() == 2: - labels = labels.view(-1) - if logits.dim() == 3: - logits = logits.view(-1, logits.shape[-1]) - assert input_ids.dim() == 1, f"Expected input_ids to be 1D (seq_len,) but got: {input_ids.shape}" - assert labels.dim() == 1, f"Expected labels to be 1D (seq_len,) but got: {labels.shape}" - assert logits.dim() == 2, f"Expected logits to be 2D (seq_len, vocab_size) but got: {logits.shape}" - assert input_ids.shape[0] == labels.shape[0], f"input_ids/labels length mismatch: {input_ids.shape[0]} != {labels.shape[0]}" - assert logits.shape[0] == input_ids.shape[0], f"logits/input_ids length mismatch: {logits.shape[0]} != {input_ids.shape[0]}" - input_ids = input_ids.cpu() - labels = labels.cpu() - logits = logits.cpu() - masked_positions = (labels != -100).nonzero(as_tuple=True)[0] - if masked_positions.numel() == 0: - self.print0("Validation preview: no masked positions in selected batch.") - return - - preds = logits.argmax(dim=-1).to(dtype=input_ids.dtype) - filled = input_ids.clone() - filled[masked_positions] = preds[masked_positions] - - original = input_ids.clone() - original[masked_positions] = labels[masked_positions] - - def _strip_pad(ids): - if (ids == pad_token_id).any(): - last_valid = (ids != pad_token_id).nonzero(as_tuple=True)[0][-1].item() - return ids[: last_valid + 1] - return ids - - input_ids = _strip_pad(input_ids) - original = _strip_pad(original) - filled = _strip_pad(filled) - - decoded_input = self.tokenizer.decode(input_ids.tolist()[:128], skip_special_tokens=False).replace(" ", "").replace("", "-") - decoded_original = self.tokenizer.decode(original.tolist()[:128], skip_special_tokens=False).replace(" ", "") - decoded_filled = self.tokenizer.decode(filled.tolist()[:128], skip_special_tokens=False).replace(" ", "").replace("", "-") - - masked_list = masked_positions.tolist()[:10] - self.print0("=" * 128, logonly=True) - self.print0("VALIDATION PREVIEW (single example)", logonly=True) - self.print0(f"Masked positions:\n{masked_list} ...", logonly=True) - self.print0(f"Raw input ids:\n{input_ids.tolist()[:10]} ...", logonly=True) - self.print0(f"Raw original ids:\n{original.tolist()[:10]} ...", logonly=True) - self.print0(f"Raw filled ids:\n{filled.tolist()[:10]} ...", logonly=True) - self.print0("-" * 128, logonly=True) - self.print0(f"Decoded input:\n{decoded_input}", logonly=True) - self.print0(f"Decoded original:\n{decoded_original}", logonly=True) - self.print0(f"Decoded filled:\n{decoded_filled}", logonly=True) - self.print0("=" * 128, logonly=True) - - def init_training(self): - self.logfile = None - if self.master_process: - os.makedirs('logs', exist_ok=True) - - # Use provided log_name or generate a random UUID - if self.args.log_name: - run_id = self.args.log_name - else: - run_id = str(uuid.uuid4()) - log_filename = f'{run_id}.txt' - - self.logfile = os.path.join('logs', log_filename) - print(os.path.basename(self.logfile)) - # create the log file - with open(self.logfile, 'w', encoding='utf-8') as f: - # begin the log by printing this file (the Python code) - print(code, file=f) - print('=' * 100, file=f) - - # Synchronize before initializing wandb - if self.ddp_world_size > 1: - dist.barrier() - - if self.master_process and self.wandb_initialized: - wandb.init( - project="speedrunning-plms", - name=run_id, - config={ - **vars(self.args), - **vars(self.model_config), - "ddp_world_size": self.ddp_world_size, - "device": str(self.device) - } - ) - - self.print0(f'Running python {sys.version}') - self.print0(f'Running pytorch {torch.version.__version__} compiled for CUDA {torch.version.cuda}\nnvidia-smi:') - result = subprocess.run(['nvidia-smi'], stdout=subprocess.PIPE, stderr=subprocess.PIPE, text=True) - self.print0(f'{result.stdout}', logonly=True) - self.print0('='*100, logonly=True) - - # Log configuration source - if self.args.yaml_path: - self.print0(f'Configuration loaded from YAML: {self.args.yaml_path}') - self.print0('CLI arguments override YAML where provided (tokens always from CLI for security)') - else: - self.print0('Configuration from CLI arguments only') - self.print0('='*50) - - self.print0(f'Model config:\n{self.model_config}') - self.print0('Args:') - for k, v in self.args.__dict__.items(): - self.print0(f'{k}: {v}') - self.print0('='*100, logonly=True) - - # calculate local batch size - self.batch_size = self.args.batch_size // self.args.grad_accum // self.ddp_world_size - - self.print0(f'Train accumulation steps: {self.args.grad_accum}') - self.print0(f'Adjusted local batch size: {self.batch_size} tokens') - self.print0(f'Across {self.ddp_world_size} GPUs') - self.print0(f'Total batch size: {self.args.batch_size} tokens') - - self.tokenizer = EsmTokenizer.from_pretrained('facebook/esm2_t6_8M_UR50D') - self.pad_token_id = self.tokenizer.pad_token_id - self.mask_token_id = self.tokenizer.mask_token_id - # Special tokens tensor for GPU-side masking (moved to GPU lazily) - self._special_tokens_cpu = torch.tensor( - [self.tokenizer.cls_token_id, self.tokenizer.eos_token_id, self.pad_token_id], - dtype=torch.int32, - ) - - # Ensure dataset is available locally (master process only), then sync - if self.master_process: - self.print0(f"Ensuring dataset '{self.args.data_name}' is available (num_chunks={self.args.num_chunks})...") - try: - ensure_hf_file(f"{self.args.data_name}_valid_%06d.bin" % 0, self.args.data_name) - ensure_hf_file(f"{self.args.data_name}_test_%06d.bin" % 0, self.args.data_name) - for i in tqdm(range(0, self.args.num_chunks + 1), desc="Ensuring dataset chunks"): - ensure_hf_file(f"{self.args.data_name}_train_%06d.bin" % i, self.args.data_name) - except Exception as e: - self.print0(f"Dataset ensure failed: {e}") - if self.ddp_world_size > 1: - dist.barrier() - - self.train_loader = self.init_dataloader(self.args.input_bin, training=True) - self.valid_loader = self.init_dataloader(self.args.input_valid_bin, training=False) - self.test_loader = self.init_dataloader(self.args.input_test_bin, training=False) - - self.print0(f'Training DataLoader: {len(self.train_loader.files)} files') - self.print0(f'Validation DataLoader: {len(self.valid_loader.files)} files') - self.print0(f'Testing DataLoader: {len(self.test_loader.files)} files') - self.print0('='*100, logonly=True) - - if self.master_process: - train_files = sorted(Path.cwd().glob(self.args.input_bin)) - self.total_downloaded_tokens = sum(self._read_bin_num_tokens(f) for f in train_files) - else: - self.total_downloaded_tokens = 0 - if self.ddp_world_size > 1: - total_tokens_tensor = torch.tensor(self.total_downloaded_tokens, device=self.device) - dist.broadcast(total_tokens_tensor, 0) - self.total_downloaded_tokens = int(total_tokens_tensor.item()) - self.epoch_counter = 1 - - self.model = self.init_model() - self.print0(summary(self.model)) - - # Initialize auto gradient clipper if enabled - if self.args.auto_grad_clip: - model_for_clipper = self.model.module if self.ddp_world_size > 1 else self.model - self.auto_grad_clipper = AutoGradClipper( - model=model_for_clipper, - clip_percentile=self.args.auto_grad_clip_p, - ) - self.print0(f"Auto gradient clipping enabled with {self.args.auto_grad_clip_p}% percentile") - - self.optimizers = self.init_optimizers() - self.lr_schedulers, self.sliding_window_size_scheduler, self.mask_rate_scheduler = self.init_schedulers() - self.print0(f"Ready for training!") - - # Push code + config to HF Hub once so the repo is ready for inference - if self.master_process and self.args.hf_model_name: - self.print0(f"Pushing code and config to {self.args.hf_model_name}...") - model_ref = self.model.module if self.ddp_world_size > 1 else self.model - model_ref.push_code_and_config_to_hub(self.args.hf_model_name) - self.print0("Code and config pushed to hub.") - - # Create decorated versions of methods that should be excluded from timing - self._run_eval_loader_timed = exclude_from_timer(self.train_timer)(self.run_eval_loader) - self._save_checkpoint_timed = exclude_from_timer(self.train_timer)(self.save_checkpoint) - - def init_dataloader(self, filename_pattern, training=True): - if self.args.patch_unet: - # Chunked loader for batched UNet: yields (B, max_length) raw input_ids - if training: - loader = ChunkedTrainLoader( - filename_pattern=filename_pattern, - max_length=self.args.max_length, - micro_batch_tokens=self.batch_size, - process_rank=self.ddp_rank, - num_processes=self.ddp_world_size, - max_epochs=1, - tokenizer=self.tokenizer, - num_workers=self.args.num_workers, - prefetch_factor=self.args.prefetch_factor, - ) - return AsyncBatchPipeline(loader) - else: - loader = ChunkedEvalLoader( - filename_pattern=filename_pattern, - max_length=self.args.max_length, - micro_batch_tokens=self.batch_size, - process_rank=self.ddp_rank, - num_processes=self.ddp_world_size, - tokenizer=self.tokenizer, - ) - return AsyncBatchPipeline(loader) - else: - # Legacy loader for standard/unet: yields (input_ids, labels, mask_rate) - if training: - if self.args.mlm: - mask_rate = self.args.mask_rate - else: - mask_rate = 1.0 - return OptimizedTrainLoader( - filename_pattern=filename_pattern, - seq_len=self.batch_size, - process_rank=self.ddp_rank, - num_processes=self.ddp_world_size, - max_epochs=1, - tokenizer=self.tokenizer, - num_workers=self.args.num_workers, - prefetch_factor=self.args.prefetch_factor, - mlm=self.args.mlm or self.args.masked_diffusion, - mask_rate=mask_rate, - ) - else: - return OptimizedEvalLoader( - filename_pattern=filename_pattern, - seq_len=self.batch_size, - process_rank=self.ddp_rank, - num_processes=self.ddp_world_size, - tokenizer=self.tokenizer, - ) - - def init_model(self): - self.print0("Initializing model...") - model = PLM(self.model_config) - self.print0(model) - model = model.cuda() - if self.args.bfloat16: - model = model.bfloat16() - - # Synchronize before compilation - if self.ddp_world_size > 1: - dist.barrier() - - if self.args.compile_model: - self.print0("Calling torch.compile()") - torch._dynamo.config.recompile_limit = self.args.dynamo_recompile_limit - model = torch.compile(model) - else: - self.print0("Skipping torch.compile()") - - if self.ddp_world_size > 1: - # Use static graph if model architecture doesn't change - model = DDP(model, device_ids=[self.ddp_local_rank], broadcast_buffers=False, gradient_as_bucket_view=True) - return model - - def init_optimizers(self): - self.print0("Initializing optimizers...") - if self.args.use_muon: - matrix_params = [ - p for n, p in self.model.named_parameters() - if p.ndim >= 2 and "embed" not in n.lower() and "lm_head" not in n.lower() and p.requires_grad - ] - embed_params = [ - p for n, p in self.model.named_parameters() if "embed" in n.lower() and p.requires_grad - ] - head_params = [ - p for n, p in self.model.named_parameters() if "lm_head" in n.lower() and p.requires_grad - ] - scalar_params = [ - p for n, p in self.model.named_parameters() - if p.ndim < 2 and "embed" not in n.lower() and "lm_head" not in n.lower() and p.requires_grad - ] - - # Confirm every parameter is mapped to an optimizer - all_params = [p for p in self.model.parameters() if p.requires_grad] - mapped_params = matrix_params + embed_params + head_params + scalar_params - assert len(all_params) == len(mapped_params), f"Muon parameter mapping mismatch: {len(all_params)} total vs {len(mapped_params)} mapped" - self.print0(f"Muon optimizer initialized: {len(matrix_params)} matrix, {len(embed_params)} embed, {len(head_params)} head, {len(scalar_params)} scalar params. Total: {len(all_params)}") - - optimizer1 = torch.optim.Adam([ - dict(params=embed_params, lr=self.args.lr_embed), - dict(params=head_params, lr=self.args.lr_head), - dict(params=scalar_params, lr=self.args.lr_scalar), - ], betas=(0.8, 0.95), fused=True) - optimizer2 = Muon(matrix_params, lr=self.args.lr_hidden, momentum=0.95) - optimizers = [optimizer1, optimizer2] - else: - params = [p for p in self.model.parameters() if p.requires_grad] - self.print0(f"AdamW optimizer initialized with {len(params)} parameters.") - optimizer = torch.optim.AdamW(params, lr=self.args.lr) - optimizers = [optimizer] - return optimizers - - def init_schedulers(self): - self.print0("Initializing schedulers...") - lr_schedulers = [] - adam_scheduler = get_scheduler( - self.args.scheduler_type, - optimizer=self.optimizers[0], - num_warmup_steps=self.args.lr_warmup_steps, - num_training_steps=self.args.num_steps - ) - lr_schedulers.append(adam_scheduler) - if self.args.use_muon: - muon_scheduler = get_scheduler( - self.args.scheduler_type, - optimizer=self.optimizers[-1], - num_warmup_steps=0, # apparently muon does not need a warmup - num_training_steps=self.args.num_steps - ) - lr_schedulers.append(muon_scheduler) - sliding_window_size_scheduler = LerpTensor(start_val=1024, end_val=self.args.max_length, precision=128) - if self.args.mask_rate_schedule: - mask_rate_scheduler = LerpFloat( - start_val=self.args.starting_mask_rate, - end_val=self.args.mask_rate, - precision=0.01 - ) - else: - mask_rate_scheduler = None - return lr_schedulers, sliding_window_size_scheduler, mask_rate_scheduler - - @torch.no_grad() - def run_eval_loader(self, loader, prefix='val'): # returns loss, tokens - # Synchronize before evaluation - if self.ddp_world_size > 1: - dist.barrier() - - loader.reset() - self.model.eval() - - # Move special tokens to GPU once - special_tokens_gpu = self._special_tokens_cpu.to(self.device) - - losses, total_tokens = [], 0 - confusion = torch.zeros((self.args.vocab_size, self.args.vocab_size), dtype=torch.int64) - preview_done = False - - if self.args.patch_unet: - # Chunked loader: yields (B, max_length) raw input_ids on GPU - raw_ids = loader.next_batch() - else: - # Legacy loader: yields (input_ids, labels, mask_rate) on GPU - input_ids, labels, mask_rate = loader.next_batch() - raw_ids = input_ids # Use input_ids for the loop condition - - # Only show progress bar on master process - pbar = tqdm(desc=f'{prefix} set', leave=False, disable=not self.master_process) - - while raw_ids.numel(): - if self.args.patch_unet: - # Apply masking on GPU with fixed eval mask rate - input_ids, labels, mask_rate = apply_masking_gpu( - raw_ids, special_tokens_gpu, self.mask_token_id, mask_rate=0.15, mlm=True, - ) - batch_valid_tokens = (input_ids != self.pad_token_id).sum() - total_tokens += batch_valid_tokens - loss, logits = self.model( - input_ids=input_ids, - labels=labels, - mask_rate=mask_rate, - sliding_window_size=self.sliding_window_size, - return_logits=True, - ) - losses.append(loss.item()) - preds = logits.argmax(dim=-1) - self._update_confusion(confusion, preds.detach(), labels.detach()) - if not preview_done: - self._print_val_preview(input_ids, labels, logits) - preview_done = True - - if self.args.patch_unet: - raw_ids = loader.next_batch() - else: - input_ids, labels, mask_rate = loader.next_batch() - raw_ids = input_ids - pbar.update(1) - pbar.close() - - avg_loss = sum(losses) / len(losses) if losses else 0.0 - - metrics = self._calculate_metrics_from_confusion(confusion) - - if self.ddp_world_size > 1: - # Convert to tensors before all_reduce - avg_loss = torch.tensor(avg_loss, device=self.device) - total_tokens = torch.tensor(total_tokens, device=self.device) - dist.all_reduce(avg_loss, op=dist.ReduceOp.AVG) - dist.all_reduce(total_tokens, op=dist.ReduceOp.SUM) - # Ensure all processes finish evaluation - dist.barrier() - - perplexity = math.e**avg_loss if isinstance(avg_loss, float) else math.e**avg_loss.item() - - self.print0( - f'{prefix} set: loss: {avg_loss:.4f} perplexity: {perplexity:.4f} ' - f'tokens: {total_tokens.item() if hasattr(total_tokens, "item") else total_tokens:,}' - ) - self.print0( - f"{prefix} metrics: acc:{metrics['accuracy']:.4f} prec:{metrics['precision']:.4f} " - f"rec:{metrics['recall']:.4f} f1:{metrics['f1']:.4f} mcc:{metrics['mcc']:.4f} " - f"tokens:{metrics['num_tokens']:,}" - ) - - return avg_loss, perplexity, total_tokens, metrics - - def save_checkpoint(self, step): - # Only master saves, but all processes wait - if self.master_process: - self.print0(f'Saving checkpoint at step {step}...') - - if self.ddp_world_size > 1: - model = self.model.module - else: - model = self.model - - # Always save locally - log = dict(step=step, model=model.state_dict(), optimizers=[opt.state_dict() for opt in self.optimizers]) - os.makedirs('logs', exist_ok=True) - torch.save(log, 'logs/state_step%06d.pt' % step) - model.save_weights_local('checkpoints', step) - self.print0(f'Checkpoint saved locally at step {step}') - - # Synchronize after saving - if self.ddp_world_size > 1: - dist.barrier() - - def train_step(self, step): - self.model.train() - - # Clear cache periodically to prevent memory fragmentation - if step % self.args.clear_cache_every == 0: - torch.cuda.empty_cache() - - # Move special tokens to GPU once (cached after first call) - if not hasattr(self, '_special_tokens_gpu'): - self._special_tokens_gpu = self._special_tokens_cpu.to(self.device) - - # Accumulate losses for proper averaging - accumulated_loss = 0.0 - - for i in range(self.args.grad_accum): - with contextlib.ExitStack() as stack: - # Only sync gradients on last accumulation step - if self.ddp_world_size > 1 and i < self.args.grad_accum - 1: - stack.enter_context(self.model.no_sync()) - - if self.args.patch_unet: - # Chunked pipeline: yields raw (B, max_length) on GPU - raw_ids = self.train_loader.next_batch() - if raw_ids.numel() == 0: - self.train_loader.reset() - raw_ids = self.train_loader.next_batch() - assert raw_ids.numel() > 0, "Dataloader returned empty batch even after reset" - # Apply masking on GPU - input_ids, labels, mask_rate = apply_masking_gpu( - raw_ids, - self._special_tokens_gpu, - self.mask_token_id, - mask_rate=self.current_mask_rate, - mlm=self.args.mlm or (self.args.masked_diffusion and self.current_mask_rate < 1.0), - ) - else: - # Legacy pipeline: yields (input_ids, labels, mask_rate) on GPU - input_ids, labels, mask_rate = self.train_loader.next_batch() - if input_ids.numel() == 0: - self.train_loader.reset() - input_ids, labels, mask_rate = self.train_loader.next_batch() - assert input_ids.numel() > 0, "Dataloader returned empty batch even after reset" - - loss = self.model( - input_ids=input_ids, - labels=labels, - mask_rate=mask_rate, - sliding_window_size=self.sliding_window_size, - return_logits=False, - ) / self.args.grad_accum - loss.backward() - accumulated_loss += loss.item() # Accumulate the scaled loss - - # momentum warmup for Muon - if self.args.use_muon: - frac = min(step/self.args.muon_momentum_warmup_steps, 1) - for group in self.optimizers[-1].param_groups: - group['momentum'] = (1 - frac) * 0.85 + frac * 0.95 - - # Apply gradient clipping if specified - clip_value = None - if self.args.auto_grad_clip and self.auto_grad_clipper is not None: - # Use auto gradient clipping - clip_value = self.auto_grad_clipper.clip_gradients() - elif self.args.grad_clip > 0: - # Use regular gradient clipping - if self.ddp_world_size > 1: - clip_grad_norm_(self.model.module.parameters(), self.args.grad_clip) - else: - clip_grad_norm_(self.model.parameters(), self.args.grad_clip) - clip_value = self.args.grad_clip - - # step the optimizers and schedulers - for opt, sched in zip(self.optimizers, self.lr_schedulers): - opt.step() - sched.step() - - # null the gradients - self.model.zero_grad(set_to_none=True) - - # Store clip value for logging - self.last_clip_value = clip_value - - # Return the total accumulated loss (already properly scaled) - return accumulated_loss - - def train(self): - self.init_training() - - train_losses = [] - - ### BEGIN TRAINING LOOP ### - self.print0("Beginning training loop...") - - # Synchronize before starting training - if self.ddp_world_size > 1: - dist.barrier() - - # Show progress only on master - pbar = tqdm(range(self.args.num_steps + 1), desc='Training steps', disable=not self.master_process) - - try: - for step in pbar: - if step == 10: # ignore first 10 steps of timing because they are slower - self.train_timer.reset() - self.train_timer.start() - timed_steps = float('nan') if step <= 11 else (step - 10) + 1 # <= 11 to avoid bug in val - - frac_done = step / self.args.num_steps # training progress - if frac_done > 1: - self.sliding_window_size = self.args.max_length - else: - self.sliding_window_size = self.sliding_window_size_scheduler(frac_done) - - if self.mask_rate_scheduler: - frac_done_mask = step / self.args.mask_rate_steps - if frac_done_mask > 1: - mask_rate = self.args.mask_rate - else: - mask_rate = self.mask_rate_scheduler(frac_done_mask) - self.current_mask_rate = mask_rate - if self.args.patch_unet: - # For patch_unet, mask_rate is applied in train_step via apply_masking_gpu - if self.args.masked_diffusion and frac_done_mask > 1: - model_for_mlm = self.model.module if self.ddp_world_size > 1 else self.model - model_for_mlm.mlm = False - else: - # Legacy path: push mask_rate to data loader workers - self.train_loader.set_mask_rate(mask_rate) - if self.args.masked_diffusion and frac_done_mask > 1 and self.train_loader.mlm: - self.train_loader.set_mlm(False) - model_for_mlm = self.model.module if self.ddp_world_size > 1 else self.model - model_for_mlm.mlm = False - # once in a while evaluate the validation dataset - if self.args.eval_every > 0 and step % self.args.eval_every == 0: - val_loss, val_perplexity, val_tokens, val_metrics = self._run_eval_loader_timed( - self.valid_loader, prefix='Validation' - ) - training_time_sec = self.train_timer.get_time() - step_avg_ms = 1000 * training_time_sec / (timed_steps - 1) if timed_steps > 1 else 0 - self.print0(f'step:{step}/{self.args.num_steps} step_avg:{step_avg_ms:.2f}ms') - tokens_seen = (step + 1) * self.args.batch_size - epoch_progress = tokens_seen / max(self.total_downloaded_tokens, 1) - current_epoch = int(epoch_progress) + 1 - if current_epoch != self.epoch_counter: - self.print0(f"(MOVING FROM EPOCH {self.epoch_counter} TO EPOCH {current_epoch})") - self.epoch_counter = current_epoch - self.print0( - f"Epoch progress: {epoch_progress:.4f} " - f"({tokens_seen:,}/{self.total_downloaded_tokens:,} tokens)" - ) - self.log_wandb( - { - 'loss': val_loss, - 'perplexity': val_perplexity, - 'tokens': val_tokens, - 'sliding_window_size': self.sliding_window_size, - 'accuracy': val_metrics['accuracy'], - 'precision': val_metrics['precision'], - 'recall': val_metrics['recall'], - 'f1': val_metrics['f1'], - 'mcc': val_metrics['mcc'], - 'epoch_progress': epoch_progress, - }, - prefix='val' - ) - - # save checkpoint every `save_every` steps - if self.args.save_every: - if step % self.args.save_every == 0: - self._save_checkpoint_timed(step) - - loss = self.train_step(step) - train_losses.append(loss) - - # everything that follows now is just eval, diagnostics, prints, logging, etc. - if step % 100 == 0: - train_time_sec = self.train_timer.get_time() - avg_loss = sum(train_losses) / len(train_losses) - - # Gather training loss across all processes for accurate logging - if self.ddp_world_size > 1: - avg_loss_tensor = torch.tensor(avg_loss, device=self.device) - dist.all_reduce(avg_loss_tensor, op=dist.ReduceOp.AVG) - avg_loss = avg_loss_tensor.item() - - log_msg = f'step:{step+1}/{self.args.num_steps} train_time:{train_time_sec:.0f} sec step_avg:{1000*train_time_sec/timed_steps:.2f}ms loss:{avg_loss:.4f} mask_rate:{self.current_mask_rate:.4f}' - if hasattr(self, 'last_clip_value') and self.last_clip_value is not None: - log_msg += f' clip_value:{self.last_clip_value:.4f}' - self.print0(log_msg) - train_losses = [] - - # Log training progress to wandb - if self.master_process and self.wandb_initialized: - log_dict = { - "time_sec": train_time_sec, - "step_avg_ms": 1000*train_time_sec/timed_steps if timed_steps > 0 else 0, - "step": step, - "loss": avg_loss, - "mask_rate": self.current_mask_rate - } - if hasattr(self, 'last_clip_value') and self.last_clip_value is not None: - log_dict["clip_value"] = self.last_clip_value - self.log_wandb(log_dict, prefix='train') - - # Stop the timer and get final training time - self.train_timer.pause() - final_training_time_sec = self.train_timer.get_time() - - self.print0(f'peak memory consumption training: {torch.cuda.max_memory_allocated() // 1024 // 1024 // 1024} GiB') - self.print0(f'Train Time: {final_training_time_sec:.0f}s | Step Avg: {final_training_time_sec/timed_steps:.2f}s') - self.print0(f'Total train time (min): {final_training_time_sec / 60:.2f}') - self.print0(f'Total train time (hours): {final_training_time_sec / 3600:.2f}') - # Save final checkpoint locally - self._save_checkpoint_timed(self.args.num_steps) - # Push final weights to HF Hub - if self.master_process and self.args.hf_model_name: - self.print0(f"Pushing final weights to {self.args.hf_model_name}...") - model_ref = self.model.module if self.ddp_world_size > 1 else self.model - model_ref.push_weights_to_hub(self.args.hf_model_name) - self.print0("Final weights pushed to hub.") - - torch.cuda.empty_cache() - torch.cuda.synchronize() - set_seed(self.args.seed) - - test_loss, test_perplexity, test_tokens, test_metrics = self._run_eval_loader_timed( - self.test_loader, prefix='Test' - ) - - self.print0(f"peak memory consumption testing: {torch.cuda.max_memory_allocated() // 1024 // 1024 // 1024} GiB") - - # Final wandb logging - if self.master_process and self.wandb_initialized: - log_dict = { - "test_loss": test_loss, - "test_perplexity": test_perplexity, - "test_tokens": test_tokens.item() if hasattr(test_tokens, "item") else test_tokens, - "test_accuracy": test_metrics['accuracy'], - "test_precision": test_metrics['precision'], - "test_recall": test_metrics['recall'], - "test_f1": test_metrics['f1'], - "test_mcc": test_metrics['mcc'], - "final_train_time_sec": final_training_time_sec, - "final_step_avg_sec": final_training_time_sec/(timed_steps-1) if timed_steps > 1 else 0, - "peak_memory_training_gb": torch.cuda.max_memory_allocated() // 1024 // 1024 // 1024, - } - self.log_wandb(log_dict, prefix='test') - - # Log final summary - log_dict = { - "val_loss": val_loss, - "test_loss": test_loss, - "test_perplexity": test_perplexity, - "train_time_sec": final_training_time_sec, - "step_avg_sec": final_training_time_sec/(timed_steps-1) if timed_steps > 1 else 0, - "peak_memory_training_gb": torch.cuda.max_memory_allocated() // 1024 // 1024 // 1024, - } - self.log_wandb(log_dict, prefix='final') - - except KeyboardInterrupt: - self.print0("\nTraining interrupted by user!") - except Exception as e: - self.print0(f"\nTraining failed with error: {e}") - import traceback - traceback.print_exc() - finally: - # Clean up resources - if self.master_process and self.wandb_initialized: - wandb.finish() - - # clean up nice - if self.ddp_world_size > 1: - dist.destroy_process_group() - - -if __name__ == '__main__': - args = arg_parser() +_SRC = Path(__file__).resolve().parent / "src" +if str(_SRC) not in sys.path: + sys.path.insert(0, str(_SRC)) - if args.bugfix: - args.hidden_size = 128 - args.num_attention_heads = 2 - args.num_hidden_layers = 2 - args.expansion_ratio = 2.0 - args.soft_logit_cap = 16.0 - args.tie_embeddings = False - args.unet = True - args.batch_size = 2048 - args.grad_accum = 1 - args.num_steps = 10 - args.cooldown_steps = 2 - args.max_length = 512 - args.auto_grad_clip = True - args.grad_clip = 0.0 # Disable regular grad clip for bugfix testing +from speedrunning_plms.training.cli import main - # Validate mode arguments - if args.mlm and args.masked_diffusion: - raise ValueError("Only one of --mlm or --masked_diffusion can be true.") - # Validate gradient clipping arguments - if args.auto_grad_clip and args.grad_clip > 0: - raise ValueError("Cannot use both --auto_grad_clip and --grad_clip at the same time. Choose one.") - - model_config = PLMConfig( - hidden_size=args.hidden_size, - num_attention_heads=args.num_attention_heads, - num_hidden_layers=args.num_hidden_layers, - num_unet_layers=args.num_unet_layers, - num_extra_layers=args.num_extra_layers, - max_sequence_length=args.max_length, - vocab_size=args.vocab_size, - expansion_ratio=args.expansion_ratio, - soft_logit_cap=args.soft_logit_cap, - tie_embeddings=args.tie_embeddings, - unet=args.unet, - patch_unet=args.patch_unet, - mlm=args.mlm or args.masked_diffusion, - masked_diffusion=args.masked_diffusion, - token_dropout=args.token_dropout, - compile_flex_attention=args.compile_flex_attention, - ) - # Initialize wandb before clearing tokens for security - wandb_initialized = False - if args.wandb_token and os.environ['WANDB_AVAILABLE'] == 'true': - wandb.login(key=args.wandb_token) - wandb_initialized = True - - if args.hf_token: - from huggingface_hub import login - login(args.hf_token) - # Clear tokens for security - args.hf_token = None - - # Clear wandb token for security but keep track that we logged in - if args.wandb_token: - args.wandb_token = None - - trainer = Trainer(args, model_config) - trainer.wandb_initialized = wandb_initialized - trainer.train() +if __name__ == "__main__": + main() diff --git a/utils.py b/utils.py index b1088b9a1..df0abdc28 100644 --- a/utils.py +++ b/utils.py @@ -1,145 +1,8 @@ -import torch -import random -import numpy as np -import time -import yaml +import sys +from pathlib import Path +_SRC = Path(__file__).resolve().parent / "src" +if str(_SRC) not in sys.path: + sys.path.insert(0, str(_SRC)) -def _get_grad_norm(model): - total_norm = 0 - for p in model.parameters(): - if p.grad is not None: - param_norm = p.grad.data.norm(2) - total_norm += param_norm.item() ** 2 - total_norm = total_norm ** (1. / 2) - return total_norm - - -class AutoGradClipper: - # Auto gradient clipping that adapts based on gradient history. - # adapted from https://github.com/pseeth/autoclip/tree/master - - def __init__(self, model, clip_percentile=10, history_length=1000000): - self.model = model - self.clip_percentile = clip_percentile - self.history_length = history_length - self.grad_history = [] - - def clip_gradients(self): - """Clip gradients based on percentile of gradient history.""" - obs_grad_norm = _get_grad_norm(self.model) - self.grad_history.append(obs_grad_norm) - - # Keep history length manageable - if len(self.grad_history) > self.history_length: - self.grad_history = self.grad_history[-self.history_length:] - - # Only start clipping after we have some history - if len(self.grad_history) >= 10: - clip_value = np.percentile(self.grad_history, self.clip_percentile) - torch.nn.utils.clip_grad_norm_(self.model.parameters(), clip_value) - return clip_value - return None - - -def load_config_from_yaml(yaml_path): - """Load configuration from YAML file.""" - with open(yaml_path, 'r') as f: - config = yaml.safe_load(f) - return config or {} - - -def set_seed(seed): - """Set seed for reproducibility across all processes.""" - random.seed(seed) - np.random.seed(seed) - torch.manual_seed(seed) - torch.cuda.manual_seed(seed) - - -def get_param_count(model): - total_params = 0 - for _, param in model.named_parameters(): - total_params += param.numel() - return total_params - - -class LerpTensor: - def __init__(self, start_val, end_val, precision): - self.start, self.end, self.prec = start_val, end_val, precision - self.prev_val = None - dtype = torch.int32 if isinstance(precision, int) else torch.float - self.gpu_val = torch.tensor(0, dtype=dtype, device="cuda") - - def __call__(self, frac_done): - val = (max((1 - frac_done), 0) * self.start + min(frac_done, 1) * self.end) // self.prec * self.prec - if val != self.prev_val: - self.gpu_val.copy_(val, non_blocking=True) - self.prev_val = val - return self.gpu_val - - -class LerpFloat: - def __init__(self, start_val, end_val, precision): - self.start, self.end, self.prec = start_val, end_val, precision - self.prev_val = None - - def __call__(self, frac_done): - val = (max((1 - frac_done), 0) * self.start + min(frac_done, 1) * self.end) // self.prec * self.prec - if val != self.prev_val: - self.prev_val = val - return self.prev_val - - -class GlobalTimer: - """Global timer that tracks elapsed time and can be paused/resumed.""" - def __init__(self): - self.total_time = 0.0 - self.start_time = None - self.is_running = False - - def start(self): - """Start the timer.""" - if not self.is_running: - torch.cuda.synchronize() - self.start_time = time.perf_counter() - self.is_running = True - - def pause(self): - """Pause the timer and add elapsed time to total.""" - if self.is_running: - torch.cuda.synchronize() - self.total_time += time.perf_counter() - self.start_time - self.is_running = False - - def resume(self): - """Resume the timer.""" - self.start() - - def get_time(self): - """Get total elapsed time including current session if running.""" - current_time = self.total_time - if self.is_running: - torch.cuda.synchronize() - current_time += time.perf_counter() - self.start_time - return current_time - - def reset(self): - """Reset the timer to zero.""" - self.total_time = 0.0 - self.start_time = None - self.is_running = False - - -def exclude_from_timer(timer): - """Decorator that pauses the timer during function execution.""" - def decorator(func): - def wrapper(*args, **kwargs): - timer.pause() - try: - result = func(*args, **kwargs) - finally: - timer.resume() - return result - return wrapper - return decorator +from speedrunning_plms.training.utils import * # noqa: F401,F403